(data stored in ACNUC7421 zone)

EMBL: CP001622.PE577

CP001622.PE577       Location/Qualifiers
FT   CDS_pept        613494..614753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0585"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00892 cyclopropane-fatty-acyl-phospholipid
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54889"
FT                   /db_xref="GOA:C6B3G8"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G8"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACS54889.1"
FT                   /translation="MASAFLSIVEKIIRKGSLKLTIANGETHTIGDGTGETVVARLADQ
FT                   EAEDAIRRDPAMKLGEMYMQGRFILEQGNIYDFLSLVKQNTTNEIFDFKMAALLLGRIA
FT                   KQQLKSRVPVNRNKHNVAHHYDLSAKLFDLFLDEDWQYSCAYFEPPGIGLDEAQLAKKR
FT                   HIAAKLLLEPNQRILEIGSGWGGMGMYLTEATDGAEFTGITLSEEQLKVSRTRAEKRGL
FT                   ADRVRFELQDYRTMTGRKFDRIVSVGMFEHVGIGHYGNFFRKVSDLLDDNGVMVLHSIG
FT                   RPKPSFGTNAFIEKYIFPGGYIPSVGEVVPPLEKAGLLVKDIEILPLHYAYTLRHWRER
FT                   FVARKAEAVALYDEQFFRMWEFYLAGSEIGFRWDELFILQIQIAKNQFAVPDNRNYIAR
FT                   NEAKLKEFEAGRAPLEKVTF"
     atggcgtcgg cattcttatc gatcgtcgaa aaaatcatcc gcaagggttc gttgaaactt        60
     accatcgcca acggcgaaac ccacactatc ggcgacggca ccggtgaaac cgttgtcgcc       120
     cgccttgccg atcaggaggc cgaggacgcc atccggcgcg acccggccat gaaactcggc       180
     gaaatgtaca tgcaaggccg gttcattctc gaacagggca acatttacga tttcctgtcg       240
     ctggtgaaac agaacaccac caacgagatc ttcgatttca agatggcggc actgctcctc       300
     ggccgcattg ccaagcagca gctgaagagc cgtgtgccgg tcaatcgcaa caagcacaat       360
     gtcgcccacc attacgatct gtcggccaag ctcttcgatc ttttcctcga cgaggactgg       420
     caatattcct gcgcctattt cgagccgccg ggcattggtc tcgacgaggc acagctcgcc       480
     aagaaacgcc atatcgccgc caagcttctg ctcgagccga accagcgtat cctggagatc       540
     ggctccggct ggggcggcat gggcatgtac ctgacggagg cgaccgacgg tgccgagttc       600
     accggcatca cactgagtga ggagcagctc aaggtctcgc gtacgcgcgc cgaaaagcgc       660
     ggccttgccg accgggtgcg gttcgaactg caggactacc gcaccatgac gggcaggaag       720
     ttcgaccgta tcgtctcggt cggcatgttc gaacatgtcg gcatcggcca ctacggcaat       780
     ttcttccgca aggtatcgga tctcctcgac gacaacggcg tcatggtgct gcattcgatc       840
     ggccgcccga agccgagctt cggcaccaat gcgttcatcg agaaatacat cttcccgggc       900
     ggctacatcc cttccgtcgg cgaggtcgtg ccgccacttg agaaggccgg actgctggtc       960
     aaggatatcg aaatcctgcc gctgcattat gcctatacgc tgcgccattg gcgcgagcgt      1020
     ttcgtggcgc gcaaggccga agcggtggcg ctttacgacg agcagttctt ccgcatgtgg      1080
     gagttctatc tggccggttc cgaaataggg ttccgctggg acgagctctt catcctgcag      1140
     atccagatcg ccaagaacca gttcgccgtt cccgacaatc gcaattacat cgcccgcaat      1200
     gaagcaaagc tgaaggaatt cgaggcgggg cgcgctccgc tcgaaaaggt gacgttctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page