(data stored in ACNUC7421 zone)

EMBL: CP001622.PE58

CP001622.PE58        Location/Qualifiers
FT   CDS_pept        complement(58490..58789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0059"
FT                   /product="integration host factor, beta subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000441 integration host factor
FT                   beta-subunit protein; TIGRFAM: integration host factor,
FT                   beta subunit; PFAM: histone family protein DNA-binding
FT                   protein; SMART: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54370"
FT                   /db_xref="GOA:C6AYE6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE6"
FT                   /inference="protein motif:TFAM:TIGR00988"
FT                   /protein_id="ACS54370.1"
FT                   /translation="MIKSELVQIVAARNPHLYHRDVENIVNAVLDEITDALAAGNRVEL
FT                   RGFGAFSVKNRPSRSGRNPRTGDTVFVEEKWVPFFKTGKELRERLNPGQADEED"
     gtgatcaagt ctgaattggt gcagattgtt gcggcacgca acccgcatct ctatcatcgc        60
     gacgtcgaga atatcgtcaa cgcggttctc gacgagatca cggatgcact ggctgcgggt       120
     aaccgagtcg aattgcgcgg gtttggcgcc ttttcggtca agaaccgccc gtcgcgctcc       180
     ggccgcaacc cgcggaccgg cgataccgtc ttcgtcgagg agaagtgggt tcccttcttc       240
     aagaccggca aggagctgcg cgagcggctc aatcccggcc aggccgacga agaggattga       300
//

If you have problems or comments...

PBIL Back to PBIL home page