(data stored in ACNUC7421 zone)

EMBL: CP001622.PE59

CP001622.PE59        Location/Qualifiers
FT   CDS_pept        complement(58819..59769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0060"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 36K type;
FT                   PFAM: peptidase S49; KEGG: rec:RHECIAT_CH0000442 proteinase
FT                   IV protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54371"
FT                   /db_xref="GOA:C6AYE7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE7"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACS54371.1"
FT                   /translation="MDSSIIADRRRLRRKLGFWRVIAVALIVALGFAFYRFALGDAGTE
FT                   RPHIAHVTISGLIVDDDELLERLKKVEISDQVKAVVISISSPGGTTYGGEKIFKAIRAI
FT                   SAKKPVVSDVRTLAASAGYMIATAGDTIIAGDSSITGSIGVIFQYPQIQPLLDKIGVSL
FT                   QEIKSSPLKAEPSPFHEASEEAKAMIRNMVVDSYNWFVDLVADRRKLPRDEVLKLADGT
FT                   IYTGRQALKVKLVDAIGGEAEIRAYLTSRGVDSDLPMVDWDKKSNTPFLLAGAVSRLIT
FT                   IFGYDDLMKTQDINGILPPKLLLDGLLSVWQVGHD"
     atggacagtt cgatcatcgc cgatcgccgg cggctgcgtc gtaagctcgg cttctggcgc        60
     gtcatcgcgg tggccctcat cgtggcactt ggtttcgcct tctaccgctt tgccctcggc       120
     gatgccggga cggagcgccc gcacatcgcc catgtgacga tatccgggct gatcgtcgat       180
     gacgacgagc ttctggagcg gctgaagaag gtcgagatca gcgatcaggt gaaggcagtg       240
     gtgatttcga tctcctcgcc cggcggcacg acctatggcg gcgaaaaaat cttcaaggcg       300
     atccgtgcaa tctctgccaa gaagcctgtc gtctccgacg tgcgcacgct tgccgcctcc       360
     gccggctaca tgatcgccac cgccggcgat acgatcattg ccggcgacag ctcgatcacc       420
     ggctcgatcg gcgtcatctt ccagtatccg cagatccagc cgctgctcga caagatcggc       480
     gtctcgctgc aggaaatcaa gtcctcgccg ctgaaggccg agccctcgcc cttccacgag       540
     gcaagcgagg aagccaaggc gatgatccgc aacatggtgg tcgacagcta taactggttc       600
     gtcgacctgg tcgccgaccg gcgcaagctg ccgcgcgacg aggtgctgaa actggccgac       660
     ggcacgatct ataccggccg ccaggcgctg aaggtgaaac ttgtcgatgc aatcggcggc       720
     gaggctgaga tccgcgccta tctgacgtca cgcggcgtcg acagtgatct gcccatggtg       780
     gactgggaca agaagagcaa tacgcccttt ctgctcgctg gggctgtttc tcggttgatt       840
     acgatcttcg gttatgatga tctcatgaaa acccaggata tcaatggaat cctgccccca       900
     aagttgcttc ttgacgggct gctttcagtt tggcaggttg gccacgattg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page