(data stored in ACNUC7421 zone)

EMBL: CP001622.PE6

CP001622.PE6         Location/Qualifiers
FT   CDS_pept        complement(5172..5891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0006"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: rec:RHECIAT_CH0000402 ribonuclease PH protein;
FT                   TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54318"
FT                   /db_xref="GOA:C6AY94"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY94"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACS54318.1"
FT                   /translation="MRPSGRKIDQMRKVSFERNFSKHAEGSCLVKFGDTHVLCTASLEE
FT                   KTPPWLRNTGKGWVTAEYGMLPRATGERMKREAAAGKQGGRTQEIQRLIGRSLRAVVDL
FT                   QALGERQITLDCDVIQADGGTRTASITGGWIALYDCLKWMESRNMIKVERVLKDHVAAI
FT                   SCGIFASQPVIDLDYIEDSSAETDANFVMTGTGGIVEIQGTAEGTPFSEGEFTSLMQLA
FT                   RNGIGELVALQKQAVEG"
     atgcggcctt caggcagaaa aatcgaccag atgcgcaagg tctcgttcga gcgcaatttt        60
     tccaagcatg cggaaggctc ctgcctggtg aagttcggcg acacgcatgt gctctgcacg       120
     gcgagtctcg aagaaaagac gccgccatgg ctgcgcaata ccggcaaggg ctgggtcacg       180
     gccgaatacg gcatgctgcc gcgggcaacc ggcgaacgca tgaagcgcga ggctgccgcc       240
     ggcaagcagg gcggccgcac ccaggaaatc cagcggctga tcggccggtc gctgcgcgcc       300
     gtcgtcgacc tgcaggcgct cggcgaacgg cagatcacgc tggattgcga cgtcatccag       360
     gccgatggcg gcacgcggac cgcctcgatc accggcggct ggatcgcgct ttacgactgc       420
     ctgaaatgga tggaaagccg caacatgatc aaggtcgaac gggtcctgaa ggatcatgtc       480
     gccgccatct cctgcggcat cttcgccagc cagccggtga tcgatctcga ttacatcgaa       540
     gactcctcgg ccgagaccga tgcgaacttc gtcatgacgg gcaccggcgg gatcgtcgag       600
     atccagggca cggccgaagg cacgccgttc agcgagggcg aattcacctc gctgatgcag       660
     cttgccagaa acggcatcgg cgaactcgtg gcactgcaga agcaagccgt cgaaggatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page