(data stored in ACNUC7421 zone)

EMBL: CP001622.PE60

CP001622.PE60        Location/Qualifiers
FT   CDS_pept        59995..60660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0061"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rec:RHECIAT_CH0000443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54372"
FT                   /db_xref="GOA:C6AYE8"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE8"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACS54372.1"
FT                   /translation="MLDTLKNNGHAAYSGSGKNAYGDALFHSARVRRLKILLPVAALIV
FT                   AASLTAVALVSIYLPENIKMEGAKIENGKVVMEKPAISGRNSDGINYSMLAERALQDIR
FT                   NPDLITLETIKAAVPMNDGLIARVVASTADYNRATDNLHMTAPFTLVLSSGLNANFQSA
FT                   QLDIKGGNMRSDDPVTITKDNASIVAKTLQITDKGRVITFEGNVRMNVDPSTIHKQGT"
     atgctcgata ccctgaagaa caacggacat gccgcctatt cagggtccgg caagaatgcc        60
     tatggcgatg cgttgttcca ttccgcccgc gtgcggcggc tgaagatatt gctgccggtg       120
     gcggccctca tcgtcgcggc gagcctcacc gcggtggcgt tagtcagcat ctatctgccc       180
     gaaaacatca agatggaagg cgccaagatc gagaacggca aggtcgtgat ggaaaagccg       240
     gcgatatcag gtcgcaattc cgacggcatc aattattcga tgctggccga aagggcgctg       300
     caggatatcc gcaatcccga tctcatcacg ctcgagacca tcaaggccgc cgtgccgatg       360
     aatgacggcc tgatcgcccg tgtcgtcgcc tcgaccgccg attacaatcg tgccaccgac       420
     aatctgcata tgacggcccc cttcaccctg gtgctgagca gcggcctcaa tgcgaatttc       480
     cagtcggcac agctcgacat caagggcgga aacatgcgga gcgacgaccc cgtcaccatc       540
     accaaggaca atgcctccat tgttgcgaag acgcttcaga taaccgataa ggggcgggtg       600
     atcacattcg aggggaatgt tcgcatgaat gtcgatccat ccaccatcca taaacagggc       660
     acttaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page