(data stored in ACNUC7421 zone)

EMBL: CP001622.PE61

CP001622.PE61        Location/Qualifiers
FT   CDS_pept        60715..61329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0062"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG:
FT                   rec:RHECIAT_CH0000444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54373"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE9"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ACS54373.1"
FT                   /translation="MAFIAGAFALILTASGAGAQQATATMPGMKLSNDQPIQIESDKLE
FT                   IHDQEHTALFTGNVKVVQGATTMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSAS
FT                   LASGSADIDKILVTDKVFLTSGTQTATADDGNFDMASQTFILTADEGKKVILSDGPNVF
FT                   TGCKLTVHMQTGQAELESCGGRVQIQLDPKSKPNTPQQKQN"
     atggcattca ttgccggcgc atttgccctt attctgacgg cctcgggcgc gggcgcgcag        60
     caggcgacgg ccacgatgcc gggcatgaag ctgtccaacg accagccgat ccagatcgaa       120
     agcgacaagc tggagatcca cgaccaggaa cacaccgctc tctttaccgg caacgtcaag       180
     gtcgtccaag gggcgacgac gatgcagtcc ggcaagatga ccgtctatta caaggacaag       240
     gcggcaaagc cggccactga cgggacgcaa ccggcggccc aacccgcagc gcagccgcag       300
     cagtctgcct cgcttgcatc ggggagtgcc gatatcgaca agatcctggt gacggacaag       360
     gtctttttga cctcgggcac gcagacggcg accgccgatg acggcaattt cgacatggcc       420
     tcgcagacat tcatcctcac cgcggatgag ggaaaaaaag ttattctgtc ggacgggccg       480
     aatgttttta ccggctgcaa gctgacggtt cacatgcaga ccggccaggc ggagcttgaa       540
     agctgcggcg ggcgtgtcca gattcagctc gatccgaagt cgaagccgaa tacaccgcag       600
     cagaagcaga actga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page