(data stored in ACNUC7421 zone)

EMBL: CP001622.PE62

CP001622.PE62        Location/Qualifiers
FT   CDS_pept        61370..62146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0063"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000445 probable amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54374"
FT                   /db_xref="GOA:C6AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54374.1"
FT                   /translation="MFGKPGPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVR
FT                   RGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQE
FT                   ASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRL
FT                   EIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLID
FT                   RAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
     atgttcggca agcccgggcc acaagctgcg ggcgccgccg acaagagccg ctatcaggga        60
     acgctgatcg cacgcggtct gacgaagacc tatgcgacgc ggcgcgtcgt caacggcgtc       120
     tcgctggtgg tgcgccgcgg cgaggccgtc ggcctgctcg gcccgaacgg cgccggcaag       180
     accacctgtt tttacatgat caccggcctg gtgccggtcg atgaaggcac gatcgagatc       240
     gacggcaacg acgtcacgac catgccgatg taccgccgat cgcgcctcgg cgtcggttac       300
     ctgccgcagg aagcctcgat cttccgaggg ttgacggtgg aagagaatat ccgcgccgtc       360
     ctcgaagtgc atgtcaagga caaggccgag cgcgagcaga agctgaacga gctgctggag       420
     gaattccata tccagaagct gcgcaagagt gccgccgtcg ccctttccgg cggtgagcgc       480
     cgccgcctcg aaatcgcccg tgcgcttgcg accgacccga ccttcatgct gctcgacgaa       540
     cccttcgccg gcgtcgaccc gatctcggtc gccgacatcc agaatctcgt tcaccacctg       600
     acggcacgcg gcatcggcgt tctcatcacc gaccacaatg tccgcgagac gctgggtctc       660
     atcgaccgcg cctacatcat ccatgccggt gaggtactga cccatggccg ggcgaacgac       720
     atcgtcaaca atccggaagt gcgccggctc tacctcggcg acaatttcag cctctga          777
//

If you have problems or comments...

PBIL Back to PBIL home page