(data stored in ACNUC7421 zone)

EMBL: CP001622.PE63

CP001622.PE63        Location/Qualifiers
FT   CDS_pept        62320..63879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0064"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 factor;
FT                   sigma-54 DNA-binding domain protein; KEGG: ret:RHE_CH00404
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54375"
FT                   /db_xref="GOA:C6AYF1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF1"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACS54375.1"
FT                   /translation="MALSANLFLRQTQSLVMTPQLMQSIQLLQMTHFELNQFIALEVEK
FT                   NPLLEFPSNDGEAGGERGEAEDGEYAHQPEDAGSDDGYDNRTEALSSDWYDNGGSASTS
FT                   RLNDELDANYTNVFPDDGAPQRLDAPELVSQWKSMPGSGEGADYDLDDFVAGQVSLRDH
FT                   LAQQIPFVLPDMADRLIAQNFVDQLDDCGYLQADIVEAGERLGTSLAQAERVLATLQSL
FT                   DPPGVFARSLAECLAIQLKQKDRYDPAMQALVENLELLARRDFATLKRLCGVDEEDLLD
FT                   MLGEIRQLNPKPGSGFEAGISEAIMPDVVVRASSDGGWLVELNPDTLPRVLVNQSYFSR
FT                   VTKNGEDHAFLSDCLQTANWLTRSLDQRAKTIMKVASEIVRQQDAFLLHGVDYLRPLNL
FT                   KTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVAGGDSHSAEAVRHKIR
FT                   ALILQESPEAVLSDDDIVDMLKKGGVDLARRTVAKYREAMNIASSVQRRREKRALAKVA
FT                   GF"
     atggcactgt ccgccaatct tttcctgcgc cagactcagt ctttggtgat gacgccgcaa        60
     ctgatgcaat ccatccagtt gctgcagatg acgcatttcg aactcaacca gttcatcgcc       120
     ctggaagtgg agaagaaccc gctgctcgaa tttccgtcga atgacggcga ggcgggcggc       180
     gaacgcggcg aagccgaaga tggagagtat gctcatcagc cggaggatgc cgggtcggac       240
     gacggttacg ataaccgcac cgaggcgctc tccagcgact ggtatgacaa tggcggcagc       300
     gccagcacca gccggctgaa cgacgagctc gacgccaatt acaccaatgt ctttcctgac       360
     gacggtgccc cgcagcgcct cgatgcgccg gagctcgtca gccagtggaa gtcgatgccg       420
     ggcagcggcg agggcgccga ctacgatctc gacgatttcg tcgccggcca ggtgtcgctg       480
     cgcgatcatc tcgcccagca gatccccttc gtcctgcccg acatggccga ccggctgatc       540
     gcgcagaatt tcgtcgacca gctcgacgac tgcggttatc tgcaggccga tatcgtcgag       600
     gcgggcgaga ggctgggcac gagcctcgca caggcagagc gcgtgctcgc caccctccag       660
     agcctcgatc cgccgggtgt tttcgcccgc agcctcgccg aatgcctggc gatccagctg       720
     aagcagaagg accgatatga cccggccatg caggctctgg tcgaaaatct cgaactgctt       780
     gcccggcgcg attttgccac gctgaagcgg ctttgcggcg tcgacgagga agatcttctc       840
     gacatgctcg gcgagatccg ccagctcaat ccgaagcccg gcagcggttt cgaggcgggt       900
     atttccgaag cgatcatgcc cgatgtggtc gtcagagcct cctcggatgg cggctggctg       960
     gtcgagctca atccggatac gctgccgcga gtgctggtca accagtctta tttttcccgg      1020
     gtgacaaaga acggcgagga tcacgccttc ctctccgatt gcctgcagac cgccaactgg      1080
     ctgacgcgca gcctcgatca gcgggctaaa accatcatga aggtggcaag cgaaatcgtc      1140
     cgccagcagg acgccttcct gctgcacggc gtcgactatc tgcgcccgct gaacctgaag      1200
     acggtcgccg aagcgatcaa gatgcatgaa tccaccgtca gccgggtcac gtcgaacaaa      1260
     tatatgctga cgccgcgcgg cctcttcgaa ctcaaatatt tcttcaccgt ctcgatcagc      1320
     gccgtcgcag gcggcgacag ccattcggcc gaagccgtgc gtcacaagat ccgcgcgctg      1380
     atcctgcagg agagcccgga ggcggtgctt tccgacgacg atatcgtcga catgctgaag      1440
     aagggcgggg tcgatctcgc ccgccgcacg gttgcgaaat acagggaggc gatgaacatt      1500
     gcctcttcgg tccagcgccg ccgcgagaag cgggcgctcg ccaaggtcgc cggtttctaa      1560
//

If you have problems or comments...

PBIL Back to PBIL home page