(data stored in ACNUC7421 zone)

EMBL: CP001622.PE64

CP001622.PE64        Location/Qualifiers
FT   CDS_pept        64007..64930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0065"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000447 putative
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54376"
FT                   /db_xref="GOA:C6AYF2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54376.1"
FT                   /translation="MPTMMRQNSNLARELFLLLVLATLWGSSYSFIKIGVETIPPITLI
FT                   AARTLIAGGILLAVLRHRRVRLPRDLATWRRFFVQACLNSVVPFTLIAWAEQSVDAGLA
FT                   VILNSATPIFTFLLTVLITRHEQVTLRRLFGVMAGLAGICLVIGVEALGGLGESLMAQL
FT                   AIILATICYAGAAIFSKNFKGLDPAVPAAGSLISGAVVLLPMSLVVDRPWEIDPSPASM
FT                   LALLALSAFSTALAFVIYFRLVQTLGSVGTTAQAYLRVPIGVAIGIVFLGERLSPTAWI
FT                   GLVCVIAGVAAMTIPARRGTTQARNA"
     atgccgacca tgatgcggca aaattccaac cttgccaggg agcttttcct gctgctggtg        60
     ctggcgaccc tttggggttc ctcctatagc ttcatcaaga tcggcgtcga gacgatcccg       120
     ccgataacgt tgatcgccgc tcgcacgctg attgccggcg gcattctgct ggccgtcctg       180
     cgccaccggc gtgtccgcct gccgcgcgat ctcgccacct ggcggcggtt tttcgttcag       240
     gcctgtctga acagcgtcgt ccccttcact ctgatcgcct gggcggaaca gtccgtcgat       300
     gccggactgg cggtgatcct gaattcggca acgccgatct tcaccttcct gctgaccgtg       360
     ctgatcaccc gccatgagca ggtgacgttg cgaaggcttt ttggcgtcat ggccgggctt       420
     gccggcatct gcctcgtcat cggcgtcgaa gcgctcggcg gtctcggcga aagcctgatg       480
     gcgcagcttg ccatcatcct ggcgaccatc tgctatgcag gtgccgcgat tttcagcaag       540
     aacttcaagg ggctcgaccc cgcggtgccg gcggccggct cgttgatctc aggcgcggtt       600
     gttctcttgc cgatgagcct cgtcgtcgat cggccgtggg aaatcgatcc ttcgccggca       660
     tcgatgctgg cgctgctggc cctctccgcc ttttcgacgg cgctcgcctt tgtgatctat       720
     ttccgtctcg tccagacgct gggttcggtc ggaaccaccg cgcaagccta tctcagagtg       780
     ccgatcgggg ttgcgatcgg catcgttttt ctcggcgaaa ggctgagccc gacggcctgg       840
     atcgggctcg tctgcgtcat agcaggtgtc gccgccatga cgatccctgc aaggaggggc       900
     acaacgcagg cacgaaacgc ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page