(data stored in ACNUC7421 zone)

EMBL: CP001622.PE65

CP001622.PE65        Location/Qualifiers
FT   CDS_pept        65223..65798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0066"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   rec:RHECIAT_CH0000448 probable sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54377"
FT                   /db_xref="GOA:C6AYF3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF3"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACS54377.1"
FT                   /translation="MSVRVSGKHMEIGESFRQRIEDQIGMAITKYFDGGYSGQVTVEKA
FT                   SSRYSADCKLHLDSGVVLHAAGEATDPQLAFDAASQRIEKRLRRYKRKLKDHHAGNHLN
FT                   GFAEVSYTVMDSVPDHDDEIADDFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKEHLNIVYRRHDGNIGWIDSASIKG"
     atgagtgtgc gtgtatccgg gaaacatatg gaaattggtg aatctttccg tcaaaggatc        60
     gaggaccaaa ttggtatggc catcacgaaa tacttcgacg ggggatattc cggccaggtg       120
     accgtggaaa aggcgagttc tcgttactcg gcggattgca agcttcatct cgacagcggg       180
     gtggtgctgc atgcggccgg cgaggcgacc gacccgcaat tggctttcga cgccgcctcc       240
     cagcggatcg aaaaacggct gcggcgttac aagcgcaagc tgaaggacca tcacgccgga       300
     aaccatctga atggttttgc agaggtctcc tacacggtta tggattccgt tcctgatcac       360
     gatgatgaaa tcgctgacga tttcgctccg gcgatcgtcg ctgaaagcac gaagcagctg       420
     aagaccatgt cggtcgccac cgcagtgatg gcgctcgaca tgaccgacga gccgcttctc       480
     ctgttccgca gccccggcaa ggaacatctg aacatcgttt accgtcggca cgacggaaat       540
     attggctgga tcgattcagc cagtatcaaa ggctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page