(data stored in ACNUC7421 zone)

EMBL: CP001622.PE66

CP001622.PE66        Location/Qualifiers
FT   CDS_pept        65869..66333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0067"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG:
FT                   rec:RHECIAT_CH0000449 protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (enzyme II of the
FT                   phosphotransferase system)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54378"
FT                   /db_xref="GOA:C6AYF4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF4"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACS54378.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARASRITGLSEREVFD
FT                   VILQRERLGSTGVGNGIAIPHGKLGNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATESASAIYAFLNEEQTSNAA"
     atggcattgg cagatttgct ccatcaggat gcgatcattc ccgccctcag agtaaattcc        60
     aagaaacagt tgcttcagga attggctgca agagcctcca ggatcaccgg gctttccgaa       120
     cgggaggtct tcgacgtcat cctgcagcgc gaacgcctgg gctcgaccgg agtcggcaac       180
     ggcatagcca ttccccacgg caagctggga aacatccatt cgatcgtcgg catcttcgcc       240
     cggctggagc agccggtcga tttcgaggcg ctggacgacc agcctgttga tctcgtgttc       300
     ctgctgcttg cgccggaggg cgcgggcgcc gatcatctca aggctctgtc gcgtatcgcc       360
     cgcgtgctac gcgatcacga tctggtcgcc aagctgcgcg ccaccgagtc cgcctcggcg       420
     atctacgcct tcctcaacga agagcagacg tcgaacgctg cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page