(data stored in ACNUC7421 zone)

EMBL: CP001622.PE68

CP001622.PE68        Location/Qualifiers
FT   CDS_pept        complement(66833..67732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0069"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ret:RHE_CH00409
FT                   ribose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54380"
FT                   /db_xref="GOA:C6AZ54"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ54"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54380.1"
FT                   /translation="MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGQVTPADAETAIGRMDEGDVLMLQLEVPAAAVEGALSAARAKGVTSILNLAP
FT                   LIPDAPRLGRLADIVIANETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADG
FT                   VIAIRDGSISRAQGLKIQPVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACL
FT                   KAGAQPSIPLSEEVADRI"
     atgatcacag ttttcgggtc catcaacatg gatctcatcg ccacgaccga gcgcctgccg        60
     aagcccggcg agacggtggc cggcaacggc tttgccacgg ccgccggcgg caagggcgcc       120
     aaccaggcgc tggcagcgcg ccgcgccggc cggtacgtgc atatggccgg cgccgtcggc       180
     aaggatgctt ttgctgcgga agcgctggcc ctgctcgatg atgcaggcac cgacctttct       240
     ctgatcaaac atgtcgacgg tccaacaggc acggcgctga tcctcgtcgg cggcgacgga       300
     gaaaacatga tcgccgtcgt tcccggcgcc aatggccagg tcacgcctgc cgatgccgag       360
     accgcgatcg gccgcatgga cgaaggcgat gtcctgatgc tgcagctcga agtgccggct       420
     gctgccgtcg aaggcgcgct gtcggccgcc cgcgccaagg gcgtcaccag catcctcaac       480
     cttgcgccgc tgatccccga tgccccgcgt ctcggccggc tcgccgatat cgtcattgcc       540
     aacgagaccg agttcgagcg gctcgccgga caagagggca tggacgccca agcgcgggag       600
     gcagcccttg tgcgtctgca tgcggagacg gggcagacgc tgatcgtgac gctcggcgcc       660
     gacggtgtca tcgccattcg cgacgggtcg atttcgaggg cgcagggtct caaaatccaa       720
     cctgtcgata cggtcggtgc gggagacact ttctgcggct atttcgccgc cagcctcgac       780
     gacggcctcg attttgtctc ggcgttgcgc cgtgcggcag tcgccggttc gctcgcctgc       840
     ctcaaggccg gagcgcaacc gtcgatcccc ttgagcgagg aagtcgcaga caggatataa       900
//

If you have problems or comments...

PBIL Back to PBIL home page