(data stored in ACNUC7421 zone)

EMBL: CP001622.PE69

CP001622.PE69        Location/Qualifiers
FT   CDS_pept        complement(67813..69036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0070"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   rec:RHECIAT_CH0000452 putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54381"
FT                   /db_xref="GOA:C6AZ55"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ55"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACS54381.1"
FT                   /translation="MTVHSESLALSLASISPAMLALVGGGLAVLVLLVIVLLLRGSGLR
FT                   REQAEEANFRAEENEARMGELLKIQAEMQGRIAAMTEVFGARQSELNQTISQRLDGMSQ
FT                   RVSSTITEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAGKIAGQQFRRDMEVHIRDISEKYLIQGETQDTAFLFVPSESIFAEIHEHFEPVVQ
FT                   KAHRARIVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVAILMDDLSRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTRRGARIEALEFEAGGDAKPARDSEAAAKSVESRTGLL
FT                   KLRVVDEE"
     atgaccgtcc attccgaatc gctcgccctt tcccttgcct cgatcagccc ggccatgctg        60
     gcgcttgtcg gcgggggtct cgccgtcctc gtcctgctgg tgatcgtgct tctgctgcgc       120
     ggctccggcc ttcgccgcga gcaggcggag gaagcgaact ttcgcgctga ggaaaacgaa       180
     gcgcgcatgg gcgagctttt gaagattcag gcagagatgc agggccgcat cgcggcgatg       240
     accgaggtct tcggcgcgcg gcagagcgaa ctcaaccaga cgatcagcca acgcctcgac       300
     ggcatgtcgc agcgagtcag ctcgacgatc accgagcaga ccaaatcgac gcatgagaac       360
     ctgcagcggc tgcaggagcg gctggcggtc atcgatgccg cgcagaacaa tatccagacg       420
     ctcgccaagg atgtcgtcgg gctgcaggcc attctgtcca acaagcagac gcgcggcgcc       480
     ttcggccagt cgagaatgga aacgatcgtc gccgacggtc tgccgatggg cgcctacgcc       540
     ttccagcaga cgctgtccaa cggttcgcgg ccggactgca cgatccgcat gccgaacggc       600
     gcgccgccgc tggtgatcga cgcaaaattt ccgctcgaag cctggaacgc tatccgagac       660
     gccggcagcc ccgaggccgg caagatcgcc ggccagcaat tccgccgcga catggaggtc       720
     catataaggg atatttccga gaaatatctg atccaggggg aaacccagga tacggccttt       780
     ctcttcgtgc cgtccgaatc gatcttcgcc gagatccatg agcacttcga gccggtggtg       840
     cagaaggcgc accgtgcgcg catcgtcatc gtctcaccgt cgctgctgat gctgtcgatc       900
     caggtcatcc aggccgtgct caaggatcag cgcatgcggg cgcaggcgca tctgatccag       960
     ggcgaagtgg cgatcctgat ggacgatctc agccgcctcg acgagcgggt gcgcaagctg      1020
     cagggccatt tcgccatggc gcagaaggat atcgacatgg tggtcacatc agccgacaag      1080
     ctcaccaggc gcggcgccag gatcgaagcg ctggaattcg aggccggcgg cgatgccaag      1140
     cctgcccgcg acagcgaagc cgcagccaaa tcggtggaga gccgcactgg tcttctgaag      1200
     ctgcgggtgg ttgacgagga gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page