(data stored in ACNUC7421 zone)

EMBL: CP001622.PE7

CP001622.PE7         Location/Qualifiers
FT   CDS_pept        6020..7108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0007"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: ret:RHE_CH00364 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54319"
FT                   /db_xref="GOA:C6AY95"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY95"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ACS54319.1"
FT                   /translation="MGIRSTSVSDAVAALDERSREIFRRIVEGYLESGEPLGSRNLSRI
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQVGDLSAEERAS
FT                   IDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPTQLIIRGRANLLEGLAGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRNQL"
     atgggcatca ggtcgacgtc ggtttcggat gccgtagctg cgctggacga gcgctccagg        60
     gaaatttttc gtcgcatcgt cgaaggttat ctggaaagcg gcgagccgct cggttcgcgc       120
     aacctgtccc gtatcctgcc gatgtcgctg tcgccggcct cggtgcgcaa tgtcatgagc       180
     gatctcgaag aactcggcct gatctattcg ccgcatgtca gcgccggccg gttaccgacc       240
     cagatcggcc tgcgcttctt cgtcgacgcc ttcatgcagg tcggcgacct ctcggccgag       300
     gaacgcgcca gcatcgaccg ccaggtgcgg gccgaaagcg gcggcaatcc cgtcgaatcg       360
     atgatgaacg aggcaagccg catgttgtcg ggcatttcgc gcggcgccgg cctggtcatc       420
     acctcgaaaa gcgatccggt gctgaaacat gtcgagttca tccggctcga accgacaaag       480
     gcgctggccg tgctcgtcgg cgatcacgat caggtggaaa accgcatcat cgagctgccg       540
     gcgggcgtca cctcctcaca gctgaccgag gcggcgaatt tcctcaatgc ccatatgtcc       600
     ggccagaccc tgccggagct tcgcaaacaa ttaagccggc tgaaggacga cgtccgtcac       660
     gagctcgatg ccctgtcgcg cgatctggtc gagcgcggca ttgccgtctg ggccggcagc       720
     ccggacgagg gaaaaccgac gcagctgatc atccgcggcc gcgccaacct gctcgaaggc       780
     ctcgccggcg ccgaggacct cgaccggctg cgcctgctgt tcgacgatct cgagaagaag       840
     gacagcctga tcgagatcct caatctcgcc gaaagcggtt cgggcgtccg catcttcatc       900
     ggatcggaaa acaagctctt ctcgctgtcc ggctcgtcgc tcatcgtcgc gccctatcgt       960
     gacgatgacg atcgcatcgt cggcgctgtc ggcgtcatcg gcccgacgcg gctcaattat      1020
     tcccgcatcg tgccgatggt ggactataca gcccagctcg tctcccgcct ttcgcgcaac      1080
     cagctttga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page