(data stored in ACNUC7421 zone)

EMBL: CP001622.PE70

CP001622.PE70        Location/Qualifiers
FT   CDS_pept        69243..70727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000453
FT                   probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54382"
FT                   /db_xref="GOA:C6AZ56"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ56"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54382.1"
FT                   /translation="MTAQQTDNALRQRLDFIELDEAARKSMRDLRPVISELIGGALDKF
FT                   YAKIAKTPAVADKSQLGHAKKRQQDHWVNLTGGTFDESYVDGVTAVGRMHERMGLEPRW
FT                   SIGGYAIVMSELVKGIMEKQWPSIFARQQGKLLAEKLSAVVKSGMLDMDYSISVYLETL
FT                   EAKRRALEEQRAEAQSDQAIALEQLRRGLEALSNGDLEATLPSDLPGNFRQMAEDYNRA
FT                   VSALRQSFASVRETSGHIKTGADVISNATNDLALRTAQQAAGVEESSAALQQLSVSVGQ
FT                   TAANAEKASDAVRETQQKAKNSGELVTSAVSAMAGIEKSSTGISKIIGVIDEIAFQTNL
FT                   LALNAGVEAARAGDAGKGFAVVAQEVRQLAQRTVEAAKEIKNLISQSSTQVNQGVGIVS
FT                   STGEALNDMISRIDIINRFVADIAAAARDQATGVNEVSLAVRNMGAITQQNSDMVEHSS
FT                   AETRRLKDEVETLIELLQHFRARPEGRSAGAARRAA"
     atgaccgccc agcagaccga caatgccctc aggcagcgcc tcgatttcat cgagctggat        60
     gaagcggcgc gcaagtcgat gcgggatctg cgccctgtca tatcagagct gatcggcggc       120
     gccctcgata aattctacgc caagatcgcc aagacccccg ctgtcgccga caagtcccaa       180
     ctgggccatg ccaagaagcg tcagcaggat cattgggtca atcttactgg cggcacgttc       240
     gacgagagct atgtcgacgg cgtgaccgcc gtcggccgca tgcatgagcg catggggctg       300
     gaaccgcgct ggtctatcgg cggttacgcc atcgtcatgt ccgaactcgt caagggcatc       360
     atggaaaagc agtggccttc gatcttcgcg cgccagcaag gcaagctgtt ggccgagaag       420
     ctatcggcgg tcgtcaaatc gggcatgctc gacatggatt attccatctc ggtctatctc       480
     gagacgctgg aagccaagcg ccgcgccttg gaagagcagc gcgctgaggc ccaatccgac       540
     caggcgatcg cgctggagca gctgcgccgc ggtctagaag cgctgtcgaa cggcgatctc       600
     gaagccactt taccgtccga tctgccgggc aatttccggc agatggccga ggactataat       660
     cgcgccgtca gcgcccttcg ccaatccttc gcctccgtgc gcgagacctc cggccatatc       720
     aagaccggcg ccgacgtcat ctccaacgcg accaacgatc tggcgctgcg caccgcccag       780
     caggcggcag gcgtcgagga gagctcggcc gcgctgcagc agctgtccgt cagcgtcggc       840
     cagacggccg ccaatgccga gaaggcgtcg gatgccgtgc gcgagacaca gcagaaggcg       900
     aagaactccg gcgaactcgt caccagcgcc gtctcggcga tggccggcat cgagaaatcc       960
     tcgaccggga tctccaagat catcggcgtc atcgatgaga tcgccttcca gaccaatctg      1020
     ctggcgctaa acgccggtgt cgaggcggcc cgtgccggcg atgccggcaa gggttttgcc      1080
     gtcgtcgccc aggaagttcg ccagctcgcc cagcgtaccg tggaagcagc caaggagatc      1140
     aagaacctga tctcgcagag ctcgacccag gtcaatcagg gtgtcggcat cgtttccagc      1200
     accggcgagg cgctgaacga catgatcagc cgcatcgaca tcatcaaccg tttcgtcgcc      1260
     gatatcgccg ccgccgcccg tgatcaggcg accggcgtca acgaggtcag cctcgccgtc      1320
     cgcaacatgg gtgcgatcac ccagcagaat tcggacatgg tcgagcactc ttcggcggaa      1380
     acccgccgcc tcaaggacga ggtggagacc ctgatcgagc tgctgcagca cttccgtgcc      1440
     cggccggagg gccgttccgc gggtgctgcc cgccgggcgg cctga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page