(data stored in ACNUC7421 zone)

EMBL: CP001622.PE71

CP001622.PE71        Location/Qualifiers
FT   CDS_pept        70825..71340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0072"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rec:RHECIAT_CH0000454 peptide deformylase
FT                   protein; TIGRFAM: peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54383"
FT                   /db_xref="GOA:C6AZ57"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ57"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACS54383.1"
FT                   /translation="MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDIAREGEEKQPQVFINPEVVKSSDERSVYEEGCLSIPDYYAEV
FT                   ERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
     atgaccatca agccactcat cattcttccc gatcccgttc tccgccagct gtccaagccg        60
     atcgagcggg tggattccga cctgcagcgt cttgccgacg atatgctgga aaccatgtat       120
     gacgcgccgg gcatcggcct cgctgccatc cagatcggcg tgccgcgccg catgctcgtc       180
     atcgacatcg ctcgcgaggg cgaggaaaag cagccgcagg tcttcatcaa cccggaggtc       240
     gtcaaatcct ccgacgagcg ctccgtctat gaggaaggct gtctttcgat tccggattat       300
     tatgccgagg tggagcgccc ggctgtcgtc tcggtcaagt atctcgaccg gaacggcaag       360
     gaacagaccg tggaagccga cggcctgctc gccacctgcc tgcagcacga gatcgaccac       420
     ctgaacggcg tgctgttcat cgattacatc tcgcggctga agcgggagat ggtgatcaag       480
     aaattcacca aggcggcgaa gtcgaaggcg ctctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page