(data stored in ACNUC7421 zone)

EMBL: CP001622.PE72

CP001622.PE72        Location/Qualifiers
FT   CDS_pept        71406..71666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0073"
FT                   /product="putative plasmid stabilization protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000455 probable plasmid
FT                   stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54384"
FT                   /db_xref="GOA:C6AZ58"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ58"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000455"
FT                   /protein_id="ACS54384.1"
FT                   /translation="MGDLLIRDVPDAMKRQLQESAQRNGRSLSEEAIEIMRRQIAVERS
FT                   RDSAGQRLRSLMSEERLSEDEVEAIAASRHERDREPPRFDT"
     ttgggcgact tgcttattcg agacgttccg gatgcgatga agcggcagct tcaggaaagc        60
     gcacaacgca acggccgcag cctttcggaa gaggcgattg aaatcatgcg ccgacagatt       120
     gcggtggagc gctcgaggga ttccgccggg cagcgcctgc gttccctgat gagtgaggaa       180
     agattgagcg aagatgaggt ggaggccatt gccgcatccc gccatgaacg ggaccgtgaa       240
     ccgccgcgtt tcgacacatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page