(data stored in ACNUC7421 zone)

EMBL: CP001622.PE73

CP001622.PE73        Location/Qualifiers
FT   CDS_pept        71663..72082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0074"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ret:RHE_CH00413 plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54385"
FT                   /db_xref="GOA:C6AZ59"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ59"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACS54385.1"
FT                   /translation="MIVLDTNVISEMQGRIHSDRILNWLDAYDVETLFLTTIAVAEMRY
FT                   GLELLDDGRRKTALVSDFNRIESEFAGRILGFALSAAHRYGLLAAERRKAGRPMETKDA
FT                   MIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
     atgatcgttc tcgatacgaa tgtgatttca gaaatgcagg ggaggatcca cagcgatcgg        60
     atattgaact ggctggacgc ctatgacgtc gagacgcttt tcctgacgac gattgccgtc       120
     gcggaaatgc gttacggtct tgaactcctt gatgatggca ggcgaaagac agcactggtg       180
     tccgacttca accggatcga gtctgaattt gccggccgca tactcggttt tgccctcagt       240
     gcagcgcatc gctacggcct gctggcggcc gagcgtagaa aggcgggacg accgatggaa       300
     accaaggatg ccatgattgc cgccatctgc cttgcaaacg gcgcgacgct tgcgacccgc       360
     aacaccagag atttcgaagg gcttgatctc aagctcgtaa acccgtttga agacggttga       420
//

If you have problems or comments...

PBIL Back to PBIL home page