(data stored in ACNUC7421 zone)

EMBL: CP001622.PE74

CP001622.PE74        Location/Qualifiers
FT   CDS_pept        72103..73038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0075"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="KEGG: ret:RHE_CH00414 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54386"
FT                   /db_xref="GOA:C6AZ60"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ60"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACS54386.1"
FT                   /translation="MSLRIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDPEERERFRGLNADVGVVVAYGLLLPEAILNGTRD
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDAKTGMMVMKMDKGLDTGAVALTREVEIGPNMT
FT                   AGELHDRLMLVGAKAMAEAMVKLEMNDLPLTPQPEDGVLYAAKIDKAETRIDFSRNAGD
FT                   VHNHIRGLAPFPGAWFELEIGGKPERVKVLASELAEGQGAAGLLLTDDLVIACGSGALR
FT                   LTRLQKAGGKPLAAADFLRGTPLAAGTRLT"
     atgtctcttc gcatcatctt catgggaacg ccggagttct cggttccgac cctgcgcctg        60
     ctcgtcgatg ccggccacag gatcgttgcg gtctatacgc agccgccgcg gccgggcggg       120
     cggcgcggcc tcgatctgca gaaatcgccg gtgcatcagg ccgccgaact gctcggcctg       180
     ccggtcttca ccccggtcaa ttttaaggac cccgaggagc gcgagaggtt tcgtggcttg       240
     aatgccgatg tcggcgtcgt cgttgcctac gggttgctgc tgccggaggc gattttgaac       300
     ggcacccgcg atggctgcta caacggtcat gcctcgctgc taccgcgctg gcgcggtgcg       360
     gcacccatcc agcgggcgat catggccggc gacgcaaaga ccggcatgat ggtgatgaag       420
     atggacaagg gtctggatac cggcgccgtg gcactcaccc gcgaggtcga gatcggcccg       480
     aacatgacgg ctggcgagtt gcacgaccgg ctgatgctgg tcggcgccaa ggcgatggcg       540
     gaagccatgg tgaaactcga aatgaacgac cttccgctga cgccgcagcc ggaagacggc       600
     gtgctctatg ccgccaagat cgacaaggcc gagacgcgca tcgatttttc caggaacgcc       660
     ggcgacgtgc acaatcacat tcgcggcctg gcgccgtttc cgggtgcctg gttcgagctc       720
     gaaatcggcg gcaagccgga gcgggtcaag gtgctggcgt ccgagctggc tgaagggcag       780
     ggtgctgccg ggctattgct gacggacgat ctcgtgatcg cctgcggctc gggcgcgctg       840
     cggctgacca ggctgcagaa ggccggcggc aagccgctgg cggcggccga tttcctcagg       900
     ggcacgccgc ttgcggcggg cacgaggctc acctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page