(data stored in ACNUC7421 zone)

EMBL: CP001622.PE75

CP001622.PE75        Location/Qualifiers
FT   CDS_pept        73038..73856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0076"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000458 tRNA-pseudouridine
FT                   synthase I protein; TIGRFAM: tRNA pseudouridine synthase A;
FT                   PFAM: tRNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54387"
FT                   /db_xref="GOA:C6AZ61"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ61"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACS54387.1"
FT                   /translation="MPRFRMTVEYDGGPYVGWQRQENGHSVQGAIEAAVLSLTGETVLV
FT                   RGAGRTDSGVHAMGQVIHADLSKEWSPYQLQNALNAHLRLAGERVSILEVEAAPEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGKHDFSTFRAAH
FT                   CQANSPVRTLDRLDVTRNGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LEARDRKACGPVAPPDGLYFMQVDYPDVIPDRRRPVTDTDANDGDADDPS"
     atgccgcgtt tccgcatgac cgtcgaatat gacggcggcc cctatgtcgg ctggcagcgg        60
     caggaaaacg gccactcggt gcagggcgcg atcgaggcgg cggtgctgtc gctgaccggt       120
     gagacggtct tggtgcgcgg cgcgggccgt accgattccg gcgtccacgc catggggcag       180
     gtgatccatg ccgatctttc gaaggagtgg tcgccctacc agttgcagaa tgccttgaac       240
     gcgcatctga ggctcgccgg cgagcgggtc tccattctcg aggtcgaggc ggctcccgag       300
     ttcttcgacg cccgtttttc ggcgctgcgg cgccattacc tctatcgcat cgtcagccgc       360
     cgggcgccgc tggcgctcga agccggcaag gcctggtggg tgccgaaggt gctcgaccac       420
     gaggtcatgc atgccgccgc ccagaggctg gtcggcaagc acgatttctc caccttccgc       480
     gccgcccatt gccaggcaaa cagcccggtg cgcaccctcg accggctgga tgtgacgcgc       540
     aacggcgaac tgatcgagat ccgtgccacg gcgcagagtt ttcttcacaa ccagatccgc       600
     tccttcgccg gcacgctgaa gctcgccggc gaaggcaaat ggacgcctga tgatgtcgag       660
     gcggcgcttg aagcgcgcga ccgcaaggcc tgcggcccag tggcgccgcc ggacgggctc       720
     tatttcatgc aggtggatta tcccgacgtg atccccgatc gccgaaggcc ggtcaccgat       780
     accgatgcca atgacgggga tgctgacgat ccctcgtaa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page