(data stored in ACNUC7421 zone)

EMBL: CP001622.PE76

CP001622.PE76        Location/Qualifiers
FT   CDS_pept        complement(73863..74459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54388"
FT                   /db_xref="GOA:C6AZ62"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ62"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00416"
FT                   /protein_id="ACS54388.1"
FT                   /translation="MPGFREVQYYLAGLWLLIRLDPRGFRYLDMSERGVNRSFWAMLWC
FT                   LPPMGISWLWWRQAFLRSMPPEADVDFPFYIRLGLVEVANWFVPLVFAGVLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLALVFFLPGSIGLVSLLLLAFMLAQVFVLARIIRMI
FT                   CHGHALMTGALTLVLLVPSMILSEYLQHFLGIYPV"
     atgccgggct ttagggaggt tcaatattac ctggccggcc tctggctgct gatccggctg        60
     gatccgcgcg gcttccgcta cctcgatatg tccgagcgcg gcgtcaatcg ctcgttctgg       120
     gcgatgctct ggtgcctgcc gccgatgggt atttcctggc tctggtggcg gcaggccttc       180
     ctgcggtcga tgccgccgga agccgatgtc gattttccct tctatatcag gctcggcctc       240
     gtcgaggtcg ccaactggtt cgtgccgctg gtctttgcag gggttctgct gcttgccttc       300
     cggatgggcg agcgtttcgc gcccgtcgtc gtcagcgtca actggctcgg cgtgccgctc       360
     tcctatatca acgggctgct gctggcgctg gtgttcttcc tgcctggatc catcggcctc       420
     gtctcgctgc tgctgctcgc cttcatgctg gcgcaggtct tcgtgctggc ccgcattatc       480
     cggatgatct gccacggtca cgcgctgatg accggggcgc tgacactggt gctgctcgtg       540
     ccatcgatga tcctttcgga atatctgcag cacttcctcg gcatctatcc cgtctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page