(data stored in ACNUC7421 zone)

EMBL: CP001622.PE77

CP001622.PE77        Location/Qualifiers
FT   CDS_pept        complement(74446..75639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0078"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: ret:RHE_CH00417 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54389"
FT                   /db_xref="GOA:C6AZ63"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ63"
FT                   /inference="protein motif:TFAM:TIGR01246"
FT                   /protein_id="ACS54389.1"
FT                   /translation="MTATDPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFALDRVK
FT                   ASEEGTPEIENLYARLGKDGPHLMFAGHTDVVPVGDEAAWTHPPFEAQISKGELFGRGA
FT                   VDMKGGIACFVAAVARHIEKNGPPNGSISFLITGDEEGPAINGTIKLLQWAAERGERWD
FT                   ACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALM
FT                   DPPFDAGTGDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRR
FT                   LEAAAGNGALRPGRDPVAYDIVWADRPSHVFLTRNNALIASLSSAVESVAGQSPRLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTAIYETFIARWFANAGL"
     atgaccgcta ccgaccccgt cgccaatctc cagacgctga ttcgctgccc gtccgtgacg        60
     cccgccgaag gcggcgcgct cacggcgctg gaggcgatgc ttgcgccgct cggctttgcg       120
     ctcgacaggg tgaaggcgag cgaagaggga acacccgaga tcgaaaacct ctatgcccgc       180
     ctcggcaagg acggcccgca tctgatgttt gccggccata ccgatgtcgt gccggtcggc       240
     gacgaagctg cctggacgca tccaccgttt gaggcccaga tttcgaaggg cgagcttttc       300
     ggccgcggcg ccgtcgacat gaagggcggc atcgcctgtt tcgtcgccgc cgtcgcccgc       360
     catatcgaga aaaacgggcc gcccaacggc tcgatttcct ttttgatcac cggcgacgaa       420
     gagggcccgg cgatcaacgg cacgatcaag ctgctgcaat gggcggccga gcgcggcgag       480
     cgctgggatg cctgccttgt cggcgagccg accaatccgg acaggctcgg cgacatgatc       540
     aagatcggcc ggcgcggctc gctgtcgggt aaaatcaccg tgcacggcgt gcagggccat       600
     gccgcctatc cgcatcttgc cgacaatccg gtgcgcggca tgctgcagct gacgcaggcg       660
     ctgatggacc cgccgtttga cgccggcacc ggcgatttcc agccttcgaa cctcgaagtg       720
     accacggtcg acgtcggcaa cccggcgacc aacgtcattc cggccaaggc atcggcaagc       780
     ttcaacatcc gcttcaacga tagctggacc gtcgaaacgc tgcgggccga aatcctgcgc       840
     cgtctggaag ccgccgccgg caacggcgca ttgcggccgg gccgcgatcc ggtggcctat       900
     gatatcgtct gggccgaccg gccgagccat gtcttcctga cgcgcaacaa tgcgctgatc       960
     gcctcactgt cttcagccgt cgaaagtgtt gccggccagt cgccgcggct ttcgaccacc      1020
     ggcggcacat cggatgcgcg cttcatcaag gattattgcc cggtcgtcga gttcggcctc      1080
     gttggccaga ccatgcacat ggtcgacgag cgcgtcgctg tcgctgatct ggagacgctg      1140
     acggcaatct acgaaacttt catcgcccgc tggttcgcca atgccgggct ttag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page