(data stored in ACNUC7421 zone)

EMBL: CP001622.PE78

CP001622.PE78        Location/Qualifiers
FT   CDS_pept        complement(75741..76601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0079"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: ret:RHE_CH00418
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54390"
FT                   /db_xref="GOA:C6AZ64"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ64"
FT                   /inference="protein motif:TFAM:TIGR00965"
FT                   /protein_id="ACS54390.1"
FT                   /translation="MSATDLASLEKIIESAFDNRDNVNTSTKGEVRDAVEAALDLLDAG
FT                   KARVAERSADGAWTVNQWLKKAVLLSFRLNDMDVVEGGSGNSTWWDKVPSKFENWGENH
FT                   FRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
FT                   DRATGEVSYGEVPPYSVVVAGSMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGIN
FT                   ELLRD"
     atgagcgcca ccgacctcgc atccctcgaa aagatcatcg aatccgcctt cgacaatcgc        60
     gacaatgtga acacgtcgac gaagggcgag gttcgcgatg cggtcgaagc agcgctcgat       120
     ctgctcgatg ccggcaaggc ccgtgtcgcc gaacgctccg ccgacggcgc ctggacggtc       180
     aatcagtggc tgaagaaggc cgtgctcttg tccttccgcc tcaacgacat ggacgtggtg       240
     gagggcggct cgggcaactc gacctggtgg gacaaggttc cctcgaagtt cgaaaactgg       300
     ggcgagaacc atttccgcgc cgccggcttc cgcgccgtgc cgaactgcgt cgtgcgccgc       360
     tcggcctata tcgccccgaa cgccatcctg atgccctcct tcgtcaatct cggcgcctat       420
     gtcggcgaag gcacgatggt cgatacctgg gcgacggtcg gctcctgtgc gcagatcggc       480
     aagcatgtgc atctctccgg cggtgtcggc atcggcggcg tgttggaacc gatgcaggcg       540
     ggcccgacga tcatcgagga caattgcttc atcggcgccc gttccgaggt ggtcgaaggc       600
     tgcatcatcc gcgaaggctc ggtgctcggc atgggcgtct ttatcggcaa gtcgaccaag       660
     atcgtcgacc gcgccacggg cgaggtgagc tacggcgaag tgccgcccta ttccgtcgtc       720
     gtcgccggct cgatgccgtc gggtaatgcg acgatgggca acggccagcc ggcgccgcat       780
     ctctactgcg ccgtcatcgt caagcgcgtc gatgaaaaga cccgctcgaa gaccggcatc       840
     aacgagctgc tcagagattg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page