(data stored in ACNUC7421 zone)

EMBL: CP001622.PE79

CP001622.PE79        Location/Qualifiers
FT   CDS_pept        76794..77660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54391"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ65"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ACS54391.1"
FT                   /translation="MAKGRNGGSRRKDGVWDPLKSSSTDKQRAEAVPKTPQTMSPAYRL
FT                   AYVDQDFLCREELRPIRLQLELLKTEMMLTERGIKSTVVMFGGARIPAPGQSAWAARND
FT                   IQRVNLEAASVYYDEARKFARLCSKYSATFNFHEYVIVTGGGPGVMEAGNRGAADEGAP
FT                   SIGLNIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFEC
FT                   LTLIQTGRMERLPLILFGETFWRSIINFEALAEFGTIAPDDVKLISFVDTAEAAWKIVQ
FT                   DFYEHRE"
     atggcgaagg gacgaaacgg cggttcgagg cgcaaggatg gcgtatggga cccgctgaag        60
     agcagttcga ccgacaagca gcgcgccgaa gccgtgccga agacgccgca gacgatgtcg       120
     cctgcctacc gcctggccta tgtcgaccag gatttcctct gccgcgagga gttgcggccg       180
     atccgtctgc agctggagct gttgaagacg gaaatgatgc tgaccgaacg cggcatcaag       240
     tcgaccgtcg tcatgttcgg cggcgcccgc attcccgccc ccggccagag cgcctgggca       300
     gcccgcaacg atatccagcg cgtcaacctg gaggcggcct cggtctatta tgacgaggcg       360
     cgcaaatttg cccggctctg ctcgaaatat tcagccacct tcaatttcca cgaatatgtc       420
     atcgtcaccg gcggcgggcc gggcgtgatg gaggccggca atcgcggcgc ggccgacgag       480
     ggcgcccctt cgatcggcct caacatcgtg ctgccgcatg agcaggcgcc gaacgcctat       540
     gtgacgccgg agctcagctt caacttccac tatttcgcca tccgcaagat gcatttcatg       600
     gtgcgcgcca aggcgatcgc ggtctttccc ggcggcttcg gcacgctcga cgaattcttc       660
     gaatgcctga cgctgatcca gaccggccgc atggagcgcc tgccgctgat ccttttcggc       720
     gagaccttct ggaggagcat tatcaatttc gaggcattgg ccgaattcgg cacgatcgcg       780
     cccgacgacg tcaagctgat cagcttcgtc gatacggctg aagctgcttg gaagatcgtc       840
     caggacttct acgaacaccg cgaatag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page