(data stored in ACNUC7421 zone)

EMBL: CP001622.PE8

CP001622.PE8         Location/Qualifiers
FT   CDS_pept        7220..7852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0008"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rec:RHECIAT_CH0000404
FT                   molecular chaperone heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54320"
FT                   /db_xref="GOA:C6AY96"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY96"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACS54320.1"
FT                   /translation="MTDDTTKNGPDATAADAAADATAYVENETAQEEAAQPDALELLKA
FT                   ENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAIPPE
FT                   TRAAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVP
FT                   NNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKPAEAETNSVFDEKDA"
     atgaccgatg acacgacgaa aaacggacct gacgcaactg cggcggatgc cgcagccgac        60
     gctaccgcct acgtcgagaa cgaaactgcg caggaagagg ccgcccagcc ggacgcgctt       120
     gagcttctga aagccgaaaa cggcgaactg cgcgaccgct atctgcgcct tgctgccgag       180
     atggacaatc tgcgccggcg caccgagcgc gaggtgaagg atgccaagtc ctattccgtc       240
     gcgggctttg cacgcgacat gctcgccgtc tcggacaatc tgcgccgcgc gctcgatgcc       300
     atccctccgg agaccagggc tgcggccgat gccggcctga gcacgctgat cgagggtgtc       360
     gagatgaccg agcgcgccat gctgtcggct ctcgagcgcc acggcgttcg caagctggag       420
     ccggttggcc agaagttcga tccgaatttc catcaggcga tgttcgaggt accgaacccc       480
     gacgtgccga acaacacggt cgtccaggtc gtgcaggcag gcttctccat cggcgagcgc       540
     gtgctgcgcc cggccatggt cggtgtcgcc aagggcggcc cgaagccggc ggaagccgaa       600
     accaactccg tcttcgacga gaaagacgcc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page