(data stored in ACNUC7421 zone)

EMBL: CP001622.PE80

CP001622.PE80        Location/Qualifiers
FT   CDS_pept        complement(77747..78385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0081"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="SMART: Calcium-binding EF-hand-containing protein;
FT                   KEGG: ret:RHE_CH00420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54392"
FT                   /db_xref="GOA:C6AZ66"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ66"
FT                   /inference="protein motif:SMART:SM00054"
FT                   /protein_id="ACS54392.1"
FT                   /translation="MYRNKLILAALSSTLIFGAAAGAGYAAPGDGPRQHPGRHGPMHGP
FT                   GPAAFREITYVRMLKQFDTNKDGQISKDEATAGIDKIFAAIDTNKDGSLTPGEIGAYQK
FT                   AQMQAMRDQRKQDASNNKDAKTADATPDNNDQGRPPQGGHEGRDGHRWMRHGGNIMRAS
FT                   IMMHRVDTDQNGRISKQEAEAGMDKLFTRMDRNKDGVISIDDMPDRPLL"
     atgtaccgca acaagctgat actggcagcg ctttcctcca ccctcatctt cggcgcagcc        60
     gccggagccg gctatgcagc gcccggtgac gggccgcgtc aacaccccgg caggcacggt       120
     cccatgcacg gtccggggcc tgccgccttc cgcgaaatca cctatgtccg catgctcaag       180
     cagttcgaca ccaacaagga cggacagatc tccaaggacg aggcgaccgc cggcatcgac       240
     aagatcttcg ctgcgatcga caccaacaag gacggctcgc tgaccccagg cgaaatcggc       300
     gcataccaga aagcgcagat gcaggcgatg agagatcagc gcaagcagga tgccagcaat       360
     aacaaggatg cgaagaccgc agacgcgacg cctgataata acgaccaggg ccggccgcct       420
     cagggtggtc acgagggtcg tgacggacat cgctggatgc gccatggcgg caacatcatg       480
     cgtgcctcga tcatgatgca ccgggtcgac accgaccaga acggccggat ttccaaacag       540
     gaagccgaag ccggcatgga caagctgttc actcggatgg accgcaacaa ggacggcgtc       600
     atctcgatcg atgacatgcc ggaccggccg cttctgtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page