(data stored in ACNUC7421 zone)

EMBL: CP001622.PE81

CP001622.PE81        Location/Qualifiers
FT   CDS_pept        complement(78490..79197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0082"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: pyrimidine 5'-nucleotidase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG:
FT                   rec:RHECIAT_CH0000464 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54393"
FT                   /db_xref="GOA:C6AZ67"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ67"
FT                   /inference="protein motif:TFAM:TIGR01993"
FT                   /protein_id="ACS54393.1"
FT                   /translation="MTKIDRTPDKADFEHVTDWVFDLDNTLYPHHVNLFAQIDKNMTAY
FT                   VAALLQMEREEARKLQKQYYLEHGTTLQGLMIHHGIDPNDFLEKAHAIDYTALTPQPEL
FT                   GEAIKALPGRKFIFTNGSVKHAEMTAEALGILEHFDDIFDIVAADYVPKPAQATYDKFM
FT                   ALKRVETTKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETVVEWWEKTSGDEDHIDFV
FT                   TDDLAAFLGKITG"
     atgaccaaga tcgaccgtac gcctgataaa gccgatttcg agcacgttac agattgggtc        60
     ttcgacctcg acaacacgct ctatccgcat catgtcaatc tcttcgcgca gatcgacaag       120
     aacatgactg cctatgtcgc ggcactcttg cagatggagc gggaagaggc gcgcaagctg       180
     cagaagcaat attatctcga gcatggcacg acattgcagg gcctgatgat ccatcacggc       240
     atcgacccga acgactttct cgaaaaggcg catgcgatcg actacacggc gctgacgccg       300
     cagccggaac tcggcgaggc gatcaaggcg ctgccggggc gcaagttcat cttcaccaat       360
     ggcagcgtca aacatgcaga gatgacggcg gaggcgctcg gcattctcga gcatttcgac       420
     gacattttcg atatcgtcgc cgccgactac gtgccgaagc cggcgcaggc gacctacgac       480
     aagttcatgg cgctgaagcg ggtcgaaacc accaaggccg ccatgttcga agatctaccg       540
     cgcaacctga cggtgccgaa ggcgctcggc atgcagactg tgctgctggt gccgcgcaat       600
     ctggaagaga cggtcgtcga atggtgggaa aagaccagcg gcgatgagga tcacatcgat       660
     tttgtcaccg acgaccttgc cgcttttctc ggcaagatta ccggctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page