(data stored in ACNUC7421 zone)

EMBL: CP001622.PE82

CP001622.PE82        Location/Qualifiers
FT   CDS_pept        79300..80376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0083"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ret:RHE_CH00423
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   protein; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; SMART: helix-turn-helix- domain containing protein
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54394"
FT                   /db_xref="GOA:C6AZ68"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ68"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACS54394.1"
FT                   /translation="MLFERPNDDTLYDALIARSADYEGQAYVCVKTTGIFCRLTCPARK
FT                   PKRENTLFFDTIAACMHSGFRPCQRCRPLEQPGREPIVDELLAALDREPQLRWSEDELV
FT                   RRGHDPSTVRRAFKRGLGMTFHDIVRYRRLGEAARQLADGARVIDAQLEAGYDSPSGFR
FT                   TAFQRLVGKAPALSQNRELLFADWFETPLGPMVAVADRTHLHLLEFHDRKALPTELEAL
FT                   QKRVRSSVAIGRTPAIDQIEAEIRDYFEGRLTVFKTPLALGGTPFEKHVWAKLMDITAG
FT                   QTRAYGDLAREMERPEVVRAVGRANGANQLAIIVPCHRILGADGSLTGYGGGLWRKQWL
FT                   LRHEEKIRAQAPNVEETA"
     atgcttttcg aacgccccaa tgacgatacg ctctatgatg ccctgatcgc gcgcagcgcc        60
     gattatgagg gccaggccta tgtctgcgtc aagacgacag gcatcttctg ccgcctgacc       120
     tgcccggcgc gcaagccgaa gcgggaaaac acgctctttt tcgatacgat cgccgcctgc       180
     atgcattccg gcttccgccc gtgccagcgc tgcaggccgc tggagcagcc gggcagggag       240
     ccgatcgtcg acgagctgct tgccgcgctc gaccgcgagc cgcagttgcg ctggagcgag       300
     gatgagcttg tgcgccgggg ccacgatccc tcgaccgtgc gccgcgcctt caaacgcggg       360
     ctcggcatga ccttccacga tatcgtccgc tatcgccgac tgggcgaggc ggcccggcaa       420
     ctggccgatg gcgcgcgcgt tatcgatgct cagcttgagg ccggatatga ctccccaagt       480
     ggtttccgga cggcttttca gcggctcgtc ggcaaggcgc cggcgctgtc gcaaaaccgt       540
     gaacttctgt ttgccgactg gttcgagacg ccgctcggac cgatggtggc cgttgccgac       600
     cggacgcatc tgcaccttct cgaattccac gaccgcaaag cgctgcccac cgaactcgag       660
     gcactgcaga agcgtgtccg ctcttcggtc gcaatcggcc gcacgccggc gatcgaccag       720
     atcgaggcag aaatccggga ttatttcgaa gggcggctca ccgtcttcaa gacgccattg       780
     gcgcttggcg gcacgccctt cgaaaaacat gtctgggcaa agctcatgga catcactgcc       840
     ggccagacgc gcgcctatgg cgatcttgca agggagatgg aaaggccgga ggtcgtgcgt       900
     gccgtcggcc gcgccaatgg cgccaaccag cttgccatca tcgtgccctg ccatcgcatc       960
     ctcggcgcgg atggttcgct gaccggctat ggcggcgggc tctggcgcaa gcaatggctg      1020
     ttgcggcatg aagagaagat cagagcacaa gcacctaacg tggaggagac ggcatga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page