(data stored in ACNUC7421 zone)

EMBL: CP001622.PE83

CP001622.PE83        Location/Qualifiers
FT   CDS_pept        80373..81143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0084"
FT                   /product="putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase protein"
FT                   /note="KEGG: ret:RHE_CH00424 putative
FT                   carboxyphosphonoenolpyruvate phosphonomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54395"
FT                   /db_xref="GOA:C6AZ69"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ69"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00424"
FT                   /protein_id="ACS54395.1"
FT                   /translation="MNQSEKAKAFGALHRKGDPVVLYNIWDAGTAKAVTDAGAKALATG
FT                   SWSVAAAHGYADGEKLPMSVLVETAKSITAVVNLPLSVDFEGAYSAEPEGAAANVAKLV
FT                   EVGAIGINFEDQVVGGGGLYPAERQAARIRAIRAMAEGEGIPFFINARTDLFLAESDLS
FT                   KHAGLVEEAIERGKAYAAAGGSGFFVPGLIDPALIEKICAASPLPVNIMMRTGAPDVKT
FT                   LAKLGVGRISYGPGPYRSMMEKLKQEAAAIYSPL"
     atgaaccaga gtgaaaaggc caaggcattc ggagcattgc accgcaaggg cgacccggtt        60
     gttctttaca atatctggga tgccggcacg gccaaggcgg tgaccgatgc cggcgccaag       120
     gcgcttgcaa caggaagctg gtcggtcgcc gctgcccatg gttatgccga cggtgagaag       180
     ctgccgatgt cggtgctggt cgagacggca aaatccatca ccgctgtcgt caatctgccg       240
     ctttcggtcg atttcgaagg cgcttattcg gctgagcctg agggtgccgc cgccaacgtc       300
     gccaagctgg tggaggtcgg cgctatcggc atcaatttcg aggatcaggt ggtcggcggt       360
     ggcgggcttt atccggccga gaggcaggcg gcccgcatcc gcgccattcg cgccatggcg       420
     gaaggcgagg gcattccctt cttcatcaac gctcgcaccg atctcttcct ggcggagagc       480
     gatctttcca aacatgccgg tctggtggaa gaggcgatcg agcggggcaa ggcctatgcg       540
     gccgccggcg gcagcggctt cttcgttcct ggcttgattg atcccgcctt gatcgagaag       600
     atctgcgccg catcgccgct gccggtcaac atcatgatgc ggacaggcgc ccctgacgtg       660
     aagacgctcg ccaagctcgg cgtcggccgc atcagttatg gtccggggcc ttaccgatcg       720
     atgatggaaa agttgaaaca ggaggcggcg gcgatttata gcccgctctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page