(data stored in ACNUC7421 zone)

EMBL: CP001622.PE84

CP001622.PE84        Location/Qualifiers
FT   CDS_pept        complement(81209..82357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0085"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ret:RHE_CH00425 L-lactate
FT                   dehydrogenase (cytochrome) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54396"
FT                   /db_xref="GOA:C6AZ70"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ70"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ACS54396.1"
FT                   /translation="MRLTDCYNFHDFRRMAKRRLPGPIFDYIDGGADDEVTYRRNTAAF
FT                   EACDLVPDVLRGVADVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAAKHGT
FT                   MFGVSSLGTISLEEARQISNGPQVYQFYFHKDRGLNREMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGMTQFAIKPSWAIDWLTHERFRLPQLENHVKMDGGALS
FT                   ISRYFTEMLDPSMSWDDVAEMVREWGGPFCLKGIMSVEDAKRAAEIGCSGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRVDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALETMRTEIERGMKLMGCTSVSQLSRRNLRFRS"
     atgcgcctga cagactgcta taattttcac gatttccggc gcatggccaa acggcgtctt        60
     cccggaccga tattcgacta tattgacggc ggtgccgacg acgaggtgac gtaccggcgc       120
     aataccgcgg ccttcgaggc ctgcgatctg gtgcccgacg ttttgcgcgg tgtggccgat       180
     gtcgacatgt cggtaactgt catgggccag aagctcgcaa tgccggtcta ttgctcgccg       240
     acggcgttgc agcggctttt tcaccaccag ggggagcggg cggtcgcggc ggcggcggca       300
     aaacatggca cgatgttcgg cgtctcctcg ctcggcacga tcagcctgga ggaagccaga       360
     cagatcagca acgggccgca ggtctatcag ttctatttcc acaaggaccg tggcctcaac       420
     cgcgagatga tggcgcgagc gaaaaatgcc ggcgtgcagg cgatgatgct gacggtcgac       480
     agcatcaccg gcggcaaccg cgagcgcgac aagcgcacgg gctttgccat tcccttcaag       540
     ctcaatcttg ccggcatgac ccagttcgcg atcaagcctt cctgggcgat cgactggctg       600
     acgcatgagc gcttccggct gccgcagctc gaaaaccacg tcaagatgga tggcggcgcg       660
     ctgtcgatca gccgatactt caccgagatg ctggacccct cgatgtcgtg ggacgacgtg       720
     gcggagatgg tgcgcgaatg gggcgggcca ttctgcctga agggcatcat gtcggtcgaa       780
     gacgccaagc gcgcggccga gatcggctgc agcggcatcg tgctttccaa tcatggcggg       840
     cgccagctcg acggctcgcg cagcgctttc gaccagttgg ccgagatcgt cgacgccgtg       900
     ggcgaccggg tcgacgtgat gatggatggc ggcgtgcagc ggggaacgca tgttcttaaa       960
     gcgctgtcgc tgggggcgaa ggccgtcggg ctcgggcgct actatctctt cccgcttgcc      1020
     gcggccggac agcccggcgt cgaacgggcg ctggagacga tgcgcaccga gatcgagcgc      1080
     ggcatgaagc tgatgggctg cacctcggtc agccagctca gccggcggaa tctgcgcttc      1140
     cgttcctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page