(data stored in ACNUC7421 zone)

EMBL: CP001622.PE85

CP001622.PE85        Location/Qualifiers
FT   CDS_pept        complement(82427..83314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0086"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: rec:RHECIAT_CH0000469 acetylglutamate kinase
FT                   protein; TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54397"
FT                   /db_xref="GOA:C6AZ71"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ71"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACS54397.1"
FT                   /translation="MNETESEMQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGVGTLIVP"
     atgaacgaaa ccgaaagcga aatgcaggca cggcttctgg ccaaagctct gcccttcatg        60
     cagcgttacg agaacaaaac gattgtcgtg aaatatggcg gtcacgccat gggcaatccc       120
     gagctcggca aggcctttgc cagcgacatc gcgctgttga agcaatcggg cgtcaacccg       180
     atcgtcgttc acggcggcgg cccgcagatc ggcgccatgc tgagcaagat gggcatcgaa       240
     tcgaaattcg agggcggcct tcgcgtcacc gaccagaaaa cggtcgagat cgtcgaaatg       300
     gtgctcgccg gctcgatcaa caaggaaatc gtcgcgctca tcaatcagac cggcgaatgg       360
     gcgatcggcc tttgcggcaa ggacggcaac atggtcttcg ccgaaaaggc gcgcaagacc       420
     atcaaagatc cggattcgaa catcgagcgc gtgctcgatc tcggtttcgt cggcgaagtg       480
     gtcgaggtcg accggacgct gctcgatctg cttgcccgct ccgagatgat cccggtcatc       540
     gcccccgtgg cgcctggccg cgacggcgcc acctacaata tcaatgcaga taccttcgcc       600
     ggcgccattg ccggtgcgct gaacgccacc cggctgctgt tcctgaccga tgtgccgggc       660
     gtgctcgaca agaacggcca gctcatcaag gagctttctg tcgccgaagc acatgcgctg       720
     atcgccgatg gcacgatttc gggtggcatg atccccaagg tcgagacctg catcgatgcg       780
     atcaaggccg gcgtgcaggg cgtcgtcatc ctgaacggca agaccgccca ttccgtgctg       840
     ctcgagatct tcaccgagca cggcgtcgga acgctgatcg ttccctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page