(data stored in ACNUC7421 zone)

EMBL: CP001622.PE86

CP001622.PE86        Location/Qualifiers
FT   CDS_pept        83458..83997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0087"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000470 RNA polymerase sigma-70 factor
FT                   protein, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54398"
FT                   /db_xref="GOA:C6AZ72"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ72"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54398.1"
FT                   /translation="MQGDDIADLIGRVALGDRRAFVALYNQTGPKLFSICLRILKDRTE
FT                   AEEALQEAYISIWQRARSFSVASGSSSAWLAAIARNRSIDALRARKPVADELDTVYDLA
FT                   DAGADPEMQTVTKDEGRRIDTCMEELEADRAVAVKRAYVEGLSYQELADQFGIPLNTMR
FT                   TWLRRSLLKLRECMER"
     atgcaaggcg atgacatcgc agacctgatc ggccgcgtcg cactcggcga tcgcagggct        60
     ttcgtggccc tctacaatca gaccggaccg aaacttttct cgatctgcct gcgtatcttg       120
     aaggatcgca cggaagccga ggaagccctg caggaagcct atatcagcat ctggcaacgc       180
     gctcgcagct tctccgtcgc ctcgggttcg tcctcggcat ggctggctgc aattgcccgc       240
     aaccggtcga tcgatgcgct gcgggcgcgc aagcccgtcg ccgacgaatt ggacacggtc       300
     tatgatctgg ccgatgccgg agccgacccg gaaatgcaga cggtgaccaa ggatgaagga       360
     aggcggattg acacctgcat ggaagagttg gaagctgatc gtgcggtcgc cgtgaaacgg       420
     gcttatgtcg aagggctgag ctatcaggaa ctggccgatc agtttggtat tccgctgaac       480
     acgatgcgga cctggctcag gcgcagcctc ttgaaactga gagagtgcat ggaacgatga       540
//

If you have problems or comments...

PBIL Back to PBIL home page