(data stored in ACNUC7421 zone)

EMBL: CP001622.PE87

CP001622.PE87        Location/Qualifiers
FT   CDS_pept        83994..84713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54399"
FT                   /db_xref="GOA:C6AZ73"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ73"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000471"
FT                   /protein_id="ACS54399.1"
FT                   /translation="MTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHDRPFA
FT                   AIVSRWETNLSAFNDEYEGVAPNRETFKQIEARLFGDGQKPPSFSQGLWNSAVFWRSLS
FT                   FACIVVAVSAVIFASGVVPEPQGPAPLVASLSGQNSTINLLASYELQSGRLKIVPVAAG
FT                   KPEEKSLELWLVPGSGMTRSLGVFQPGESGELVIPADLRSQVADGATLAVSLEPFGGSP
FT                   TGQATGPVIASGPLHRP"
     atgacatcgc ccgataaaag caagggagac cgctcccgcg acgaggttct cgccggcgaa        60
     tatgtgcttg gcgtcctgtc gttgcaggat cgccgggtgg tggaagagcg catgcgccac       120
     gaccgcccct tcgctgcgat cgtcagccgc tgggaaacca acctctccgc cttcaacgac       180
     gagtatgaag gcgttgctcc gaaccgggaa accttcaagc agatcgaggc acggctgttc       240
     ggcgatggcc aaaagccccc atccttttcg caggggctct ggaattccgc cgttttctgg       300
     cgctcgctga gcttcgcctg catcgtcgtc gccgtcagcg ctgtcatctt cgcctccggc       360
     gtggtgccgg agccgcaggg gccggcacca ctggtagcct cgctttcggg ccagaacagc       420
     accatcaatc ttctcgcctc ctatgagctg cagagcggcc ggctgaagat cgtgccggtc       480
     gccgccggca agccggagga gaagtcgctg gaactctggc tggtaccggg cagcggcatg       540
     acgagatcgc tcggcgtctt ccagccgggc gagagcggtg aacttgtcat ccccgccgat       600
     ctgcgcagcc aggtcgccga tggcgcaacg cttgccgtca gcctcgaacc cttcggcggt       660
     tcgccgaccg gccaggcgac cggtccggtg atcgcaagcg gtcccctgca ccgaccataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page