(data stored in ACNUC7421 zone)

EMBL: CP001622.PE88

CP001622.PE88        Location/Qualifiers
FT   CDS_pept        84836..85390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0089"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; SMART:
FT                   beta-Ig-H3/fasciclin; KEGG: rec:RHECIAT_CH0000472 putative
FT                   transforming growth factor-induced protein (and secreted
FT                   protein MPB70)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54400"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ74"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACS54400.1"
FT                   /translation="MIKSVLRGVALATAMSAVAFAAAKNPVVGGAAMFDSKNIIENAVN
FT                   SKDHTTLVAAVKAAGLVGTLEGKGPFTVFAPTNEAFAALPKGTVDTLLKPENKATLTKV
FT                   LTCHVVAADAMAKTVAKMIKDDGGEHDIKTVGGCVLKAKENMGKITLTDENGGVSHVTI
FT                   ADVKQSNGVIHVVDKVLLPKM"
     atgatcaagt ccgtattgcg cggcgtcgcg ctcgccacag ccatgtccgc cgtcgccttt        60
     gccgccgcca agaatccagt ggtcggcggc gctgcgatgt tcgatagcaa gaacatcatc       120
     gagaacgccg tgaattccaa agatcacacg acgctggtcg cagccgtcaa ggcggcaggc       180
     ctggtcggca cgctcgaagg caagggcccc ttcaccgtct ttgcgccgac caacgaagct       240
     tttgccgcgc tgccgaaggg caccgtcgat acgctgctga agccggaaaa caaggcgacg       300
     ctgaccaagg ttctgacctg ccacgtcgtt gccgccgatg cgatggccaa gaccgttgcc       360
     aagatgatca aggatgacgg cggcgagcac gacatcaaga ccgtcggcgg ctgcgtgctg       420
     aaagccaagg aaaacatggg caagatcacc ctgaccgatg aaaacggcgg tgtctcccat       480
     gtgacgatcg ccgacgtcaa acagtcgaac ggcgtcatcc atgtcgtcga caaggtgctg       540
     ctgccgaaga tgtaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page