(data stored in ACNUC7421 zone)

EMBL: CP001622.PE89

CP001622.PE89        Location/Qualifiers
FT   CDS_pept        complement(85663..86739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0090"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation/phosphoacceptor;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000473 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54401"
FT                   /db_xref="GOA:C6AZ75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ75"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACS54401.1"
FT                   /translation="MTDSKDQPISPEGVGNLPHLAEALDDDRFRHFLDHVPFAVAVSEL
FT                   GGNEPLIYVNLEFERLTALGATEVQGKPWPDIELNSTAVSGEVPLTAAVTSAEEYIGAF
FT                   SLVAEPESTVIIDVWSNTIVDDDDTPLFRLVAFAARSEATAAESFSELLTEKDVLLREL
FT                   QHRVKNNLQMITALIRMEARNAQQNEESERFARLAGRIEALALLYRSLSDEEKGATVDL
FT                   GTYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVDVAMPAGLVINELLTNTLKHAFVGRD
FT                   GGEITLRCVVSETGCRITVADNGVGLPQDVTWPQPGKLSAMIVQSLKQNARAEVEVSSS
FT                   PDTGMSVSLVFPRAEAAQ"
     atgaccgata gcaaagacca gccgatttcg cccgaaggcg tcggcaactt gccccacctt        60
     gccgaagccc ttgacgatga ccggtttcga cactttctcg atcatgtgcc attcgcggtg       120
     gctgtctccg aactcggtgg gaacgagccg ctgatttacg tcaacctcga attcgaacgg       180
     ctgacggcgc ttggggcaac cgaggtccag gggaaaccct ggccggacat tgaattgaat       240
     tccaccgccg tctccggaga ggtgccgctc acggcagctg tgacctctgc tgaggaatat       300
     attggtgcct tctcgctggt ggccgaaccc gagagcaccg tcattatcga tgtctggtcg       360
     aatacgatcg tcgacgatga tgacacgccg cttttccgat tggtggcctt tgctgcccgc       420
     agtgaggcga cagccgccga gagcttcagc gaactgctga cggagaaaga tgtccttctg       480
     cgggaactac agcatcgcgt gaagaacaat ctccagatga tcacggcgct catccgaatg       540
     gaggcgcgca atgctcaaca gaatgaggaa agcgaaagat ttgcacggct tgccgggcgg       600
     attgaagcct tggccctgct ctatcgctcg ctgtcagacg aagagaaagg cgccactgtc       660
     gatcttggca cctatgtcag ccagattgcc gcctcggtga tggcggccca tgccgtggaa       720
     gggatccggc tggacatgaa ggtcgatacc tggccggttt cggtcgatgt cgccatgccg       780
     gccggcctcg tcatcaacga actcctcacc aatacgctga agcatgcctt cgtggggcgt       840
     gatggcggcg aaatcacact ccgctgtgtc gtcagcgaaa ccggctgcag gatcaccgtt       900
     gctgataacg gggtcggtct tccccaggat gtgacctggc cgcagccggg aaagctgagc       960
     gcgatgatcg tacagtcact gaaacagaat gcccgcgccg aggttgaagt cagctcatcc      1020
     cctgacaccg gcatgagtgt ctccctcgtc ttcccgagag ctgaagcggc ccaatag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page