(data stored in ACNUC7421 zone)

EMBL: CP001622.PE9

CP001622.PE9         Location/Qualifiers
FT   CDS_pept        complement(7917..8861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0009"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000405
FT                   inosine-adenosine-guanosine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54321"
FT                   /db_xref="GOA:C6AY97"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY97"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACS54321.1"
FT                   /translation="MASARKIIIDTDPGQDDAAAIMLAFGSPDELEVLGITTVAGNVPL
FT                   SLTSRNARIVCELCERTETKVFAGADAPIARKLVTAEHVHGKTGLDGPELNEPTMALQP
FT                   GHAVDFIIETLRHEPEGTVTLCTLGPLTNIGMAFQKAPDIIPRIRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADIVFRSGVPIVMMPLDVTHQLLTRKDRVKRMAEIGTAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVVAYLLKPELFQGRDCNVEIEVQSELTVGMTVVD
FT                   WWHVTERKRNAKVMRHVDADGFFDLLIERFARI"
     atggcaagcg caagaaagat catcatcgac acggatcccg gccaggacga cgcggccgcc        60
     atcatgctgg ccttcggcag tcccgatgag ctggaggtgc tggggatcac gacggtcgcc       120
     ggcaacgtgc cgctttcgct caccagccgc aatgcgcgca tcgtctgcga gctttgcgaa       180
     cggacggaga cgaaggtttt cgccggcgcc gacgcaccga tcgcccgcaa gctggtgacg       240
     gccgaacatg tgcacggcaa gaccggcctc gacggtccgg agctgaacga gccgacgatg       300
     gcgctgcagc ctggccatgc cgtcgacttc atcatcgaga cgttgcgcca tgagcctgaa       360
     ggcacggtga cgctgtgcac gctcgggccg ctcaccaata tcggcatggc cttccagaag       420
     gcgcccgaca tcatcccccg catccgcgaa ctggtgatga tgggcggcgg cttcttcgag       480
     ggcggcaaca tcacgccggc ggccgaattc aacatctatg tcgaccccga agccgccgat       540
     atcgtcttcc gctcaggcgt tccgatcgtg atgatgccgc tagatgtgac gcatcaattg       600
     ctgacccgca aggaccgggt gaaacgcatg gccgagatcg gcacggcgcc ggcaaaggcc       660
     atggtcgaga tgctcgaatt cttcgaacgc ttcgacatcg agaaatacgg ttccgacggc       720
     gggccgctgc acgacccgac cgtcgtcgcc tacctgctga agccggagct tttccagggc       780
     cgggactgca atgtcgagat cgaggtccag tccgaactca ccgtcggcat gacggtcgtc       840
     gactggtggc atgtgaccga gcgcaagcgc aacgccaagg ttatgcgcca tgtcgatgcg       900
     gatggctttt tcgatctgct gatcgaacgc ttcgcccgca tctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page