(data stored in ACNUC7421 zone)

EMBL: CP001622.PE90

CP001622.PE90        Location/Qualifiers
FT   CDS_pept        complement(86861..87136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54402"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ76"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00433"
FT                   /protein_id="ACS54402.1"
FT                   /translation="MAETPQELQSINTAWQIAIQEILRMVIRDMYHGGGEASFKTHIKR
FT                   IEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRA"
     atggcagaga ctccgcagga acttcagtcg atcaatacgg cctggcagat cgccattcag        60
     gaaattctgc gcatggtgat cagagacatg tatcacggcg gcggcgaggc ttcgttcaag       120
     acgcatatca agcgtatcga agaagcggcc gtcgacagta tttacacgga tttgcggctg       180
     cgcgggactg atgaatggac ggaagtgctg gtcaaggaaa gggcgagcaa tttcgtcacg       240
     accctgctga cgtcatttac ctatgaccgg gcttaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page