(data stored in ACNUC7421 zone)

EMBL: CP001622.PE92

CP001622.PE92        Location/Qualifiers
FT   CDS_pept        complement(87615..87824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0093"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rec:RHECIAT_CH0000476 probable cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54404"
FT                   /db_xref="GOA:C6AZ78"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ78"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS54404.1"
FT                   /translation="MATGTVKWFNSTKGFGFIQPDNGGDDAFVHISAVERAGMRELVEG
FT                   QKIGFDLERDNKSGKMSACNLQNA"
     atggccactg gcacagttaa atggttcaat tccaccaaag gcttcggctt cattcagcct        60
     gataatggcg gcgacgacgc cttcgttcac atctccgccg tcgagcgcgc cggaatgcgc       120
     gaactcgtcg aaggccagaa gatcggcttc gacctcgagc gcgacaacaa gtcgggcaag       180
     atgtccgctt gcaatctcca gaacgcttaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page