(data stored in ACNUC7421 zone)

EMBL: CP001622.PE93

CP001622.PE93        Location/Qualifiers
FT   CDS_pept        complement(88092..88745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0094"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ret:RHE_CH00436 GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54405"
FT                   /db_xref="GOA:C6AZ79"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ79"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACS54405.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGQDLPPTAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKI
FT                   KAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETVGIARWK"
     atgcccgaaa ccgaaaagcc gctcttcggc cacccgtgga tcttcatccg cggcgtaccg        60
     tccctgaact tcctgccgcc ggaagggccg ttggaagtgg cctttgccgg tcgctcgaat       120
     gtcggcaaat cctcgctgat caatgcgctg gtcggtcaga agggcctggc gcgcacctcg       180
     aacacgccgg gacgcacgca ggaactgaac tatttcgttc cggacggtta ttccggcgaa       240
     ggccaagacc tgccgccgac ggcgatcgtc gacatgccgg gctatggtta tgcgcaggcg       300
     ccgaaagagc aggtcgacaa atggaccaag ctcgtcttcg attacctgcg cggccgcgcg       360
     acgctgaagc gcgtctatgt gctgatcgac agccgccacg gcatcaagaa gaacgacgac       420
     gacgtgctcg atctgctcga caaggccgcc gtctcctacc agatcgtgct gaccaagacc       480
     gacaagatca aggcggctgg cgtgccgaag ctgcttgccg aaacggcaga aaagatccgc       540
     aagcgcccgg ccgcctatcc cggcgtgctg tccacctcct cggaaaaggg cgatggactg       600
     gacgaactgc gccaggcgat cgccgaaacc gtcggtatcg cccgctggaa gtag             654
//

If you have problems or comments...

PBIL Back to PBIL home page