(data stored in ACNUC7421 zone)

EMBL: CP001622.PE94

CP001622.PE94        Location/Qualifiers
FT   CDS_pept        complement(88899..90692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0095"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   rec:RHECIAT_CH0000478 inner membrane transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54406"
FT                   /db_xref="GOA:C6AZ80"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ80"
FT                   /inference="protein motif:PFAM:PF02096"
FT                   /protein_id="ACS54406.1"
FT                   /translation="MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQ
FT                   TEQVQQPAAGGQTPAQPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGAR
FT                   LDDLKLKGYHETVDDSSPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEG
FT                   AKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYN
FT                   KPTTPSVYVLHEGFIGVIGDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVP
FT                   PQSAPYEASFSHFADGQPRYQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEAS
FT                   YSIPKFDRLIDWGWFYFITKPMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQY
FT                   ASMANMKRMQPKMEELKAKFADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSL
FT                   YKVIYITIEMRHAPFFGWIKDLSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMF
FT                   LQMRMNPTPPDPTQAMIFTWMPLVFMFMLASFPAGLVIYWAWNNTLSVAQQSVIMKRHG
FT                   VKVELFDNLKGLFRRKTAPSK"
     atggaaaaca accgcaatta cttcattgcg atcgctctct cggtgctgat cgtcctcggc        60
     tggcaatttc tctatatgaa tccacgcatc gaggcccagc gcaaggtgca ggaagcccag       120
     aaggcgcagc agcagaccga gcaggtgcag cagccggcag caggcggtca gacgccggcc       180
     cagccgagcg gtgcggcacc taccagccag gcggccgcaa cggcgacgct cgagcaggcg       240
     ctggcaaaga gcccgcgcgt cgtcatcgac actgctgccc tctccggctc gatcaatctt       300
     gccggcgccc gcctcgacga cctgaagctc aagggctacc acgagaccgt cgacgactcg       360
     agcccgatca tcacgctgtt cagcccggcc gaaaccaagg acggttactt caccgagctc       420
     ggctatatcg gtagtgacgc gacaggcagc gttcccggtc cctcgacgct ctggacggct       480
     ccggagggcg ccaagctcac cgaaaagacg ccggtgacgc tttcctacac caatgacaag       540
     ggtctgacct tcacccgcac catctccgtc gacgaacgct acatgttcac cgtcgccgac       600
     aagatcgaga atgccggcca ggctcccgcc tcgctcaatt cttacggccg tgtcacgcgt       660
     tacaacaagc cgacgacgcc ctcggtctac gtgctgcatg aaggcttcat cggcgtcatc       720
     ggcgacgacg gcctcgtcga aaccaaatat accgccgccg aaaaggaagc cgtcaagccg       780
     gccaaatcca ccggtggctg gctcggcatc accgacaaat actgggccgc gacgatcgtt       840
     ccaccgcaga gcgctcccta tgaggcaagc ttctcgcatt ttgccgacgg tcagccgcgc       900
     tatcaggccg actacaagga agatgccttc accgttgcgc ctggccaatc gatcgagctg       960
     aagaacctcg tcttcgccgg cgccaaggaa gtgcccgtca tcgacggtta tgaggccagc      1020
     tactcgatcc cgaagttcga ccggctgatc gactggggct ggttttattt catcaccaag      1080
     ccgatgttca agctgatgga cttcttcttc cgctacttcg gcaatttcgg cgtggcgatc      1140
     ctgtgcacca ccatcgtcgt caagctcctg ttcttcccgc tcgccagcaa gcagtacgct      1200
     tcgatggcga acatgaagcg catgcagccg aagatggagg aactgaaggc gaaattcgca      1260
     gacgaccgca tggggctgca gcaagcgacg atgcagctct acaaggaaga gaagatcaat      1320
     ccgatcgccg gctgctggcc ggtggcgctg cagatcccga tcttcttctc gctctataag      1380
     gtgatctaca tcaccatcga gatgcggcat gcgccgttct tcggctggat caaggacctt      1440
     tcggcgcccg atccgacgac gatcgtcaat ctgttcggcc tgctgccctt cgaggcgccg      1500
     accattctgc atctcggcgt ctggccgctg atcatgggcg tcacgatgtt cctgcagatg      1560
     cgcatgaacc cgacgccgcc cgatccgacg caggcgatga tcttcacttg gatgccgctg      1620
     gtgttcatgt tcatgctggc aagcttcccg gccggcctgg tcatctactg ggcctggaac      1680
     aacacgctct cggtggcgca gcagtcggtg atcatgaagc gccacggcgt caaggtcgaa      1740
     ctcttcgaca atctgaaggg tctgttccga cgaaaaacgg caccgtcgaa atga            1794
//

If you have problems or comments...

PBIL Back to PBIL home page