(data stored in ACNUC7421 zone)

EMBL: CP001622.PE95

CP001622.PE95        Location/Qualifiers
FT   CDS_pept        complement(90692..91093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0096"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: rec:RHECIAT_CH0000479
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54407"
FT                   /db_xref="GOA:C6AZ81"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ81"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ACS54407.1"
FT                   /translation="MAGELTISEKKHTVGRLKSRPQFLAAREGEKRRGGLFLLEVLDRK
FT                   EPDSQARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLDAS
FT                   FQELAAELKSRVETRPKHRRSGDGRPRNV"
     atggcgggcg aattgacgat cagtgagaaa aaacacactg tcgggcggct gaagagccgc        60
     ccgcagtttc ttgccgcgcg cgagggcgaa aaacgccggg gcggcctctt ccttctcgaa       120
     gtcctcgacc ggaaggaacc cgacagccag gcacgcgtcg gttttacagt caccaaaaaa       180
     catggcaacg cggtcgaacg gaaccgcatg cgccgccgcc tgaaagaggc ggtgcggctt       240
     catgcggggt ttgcaatgca gcccggacac gactatgtgg ttgtcgcgcg cagggacgtg       300
     ctagacgcgt ccttccagga attggccgcg gaactgaaat cccgcgtgga aaccaggccg       360
     aaacaccggc gctccggaga cggacgcccc aggaacgtat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page