(data stored in ACNUC7421 zone)

EMBL: CP001622.PE96

CP001622.PE96        Location/Qualifiers
FT   CDS_pept        complement(91114..91248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0097"
FT                   /product="ribosomal protein L34"
FT                   /note="TIGRFAM: ribosomal protein L34; PFAM: ribosomal
FT                   protein L34; KEGG: rec:RHECIAT_CH0000480 50S ribosomal
FT                   protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54408"
FT                   /db_xref="GOA:C6AZ82"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ82"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ACS54408.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGRKVIAARRAQGRNRLSA"
     atgaagcgta cctaccaacc atccaagctt gttcgcaagc gtcgccacgg tttccgtgcg        60
     cgcatgtcca cgaagggtgg ccgcaaggtc atcgcagccc gccgcgcgca gggccgcaat       120
     cgtctgtcgg cgtaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page