(data stored in ACNUC7421 zone)

EMBL: CP001622.PE97

CP001622.PE97        Location/Qualifiers
FT   CDS_pept        91668..93665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0098"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000481 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54409"
FT                   /db_xref="GOA:C6AZ83"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ83"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54409.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMHEYSRNLTAYEHAAAR
FT                   AYAGERLNRFVTAVVMEARGIYAAKTIKDTPNFAKGLMADLDEIDKVISGWAPLVPESQ
FT                   KADFAKLVARAAEFRTFRTETVRLGTEVGPEAAGQQGNNDANRANRKAFQAEIDAVVAT
FT                   DKAALETVNAEIESFRSWVLMLVLSITGIGIAVGVGMGFYIGTSHLSRPIKRVTHAIKE
FT                   VADGNFDAEVPFAGRPDEIGEMAAAVAVFKANGLAIKRLNAQEAAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFGHRISKDYEDDNLNQFAGNINMLLSSVDAGIGETRRVIASLAEGDLTQT
FT                   MSGNFQGAFAELQQNVNNTFVTLQATMREVRETTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEETSAALDEITAVVQNSTERAHEATIMVSEAKENAGRSGVVVRNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGNEVQVGVKLVQATGEALAEIGTRVIAINDHIHSIATAATEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEAGGLVRLIARFKLSDDAPAPAALVRNEPHRP
FT                   VASPARRAIAKVARAFGGNAAAAEQSWEEF"
     ttgaagatcc ggggcaaaat taatctgctg gtttgcgtga tgggcgcggt ggcgcttttg        60
     atcggcgcaa cggcgttgtc cgccatgcac gaatacagtc gcaacctgac ggcttacgag       120
     catgccgcag cccgtgccta tgcgggcgaa cgcctcaacc gtttcgtcac ggcggtggtc       180
     atggaagcgc gcggcatcta tgccgccaaa acgatcaagg atacgccgaa cttcgccaag       240
     ggcctgatgg ccgatctcga cgagatcgac aaggtcatct cgggctgggc gccgctcgtt       300
     cccgagagcc agaaggccga ctttgccaag ctcgtcgccc gcgccgcgga attccgcacc       360
     ttccgcacgg aaacggtccg tctcggcacg gaagtcggcc ccgaagccgc tggccaacag       420
     ggcaacaatg acgccaaccg cgccaaccgc aaggcgttcc aggcggaaat cgatgcggtc       480
     gtcgccaccg acaaggcagc gctggagacc gtcaacgccg agatcgagag cttccgctcc       540
     tgggtgctga tgcttgtact cagcatcacc ggcatcggca tcgcggtcgg cgtcggcatg       600
     ggcttctata tcggcaccag ccatctcagc cgcccgatca agcgcgtcac ccatgcgatc       660
     aaggaagttg ccgacggcaa tttcgacgcc gaggtcccct ttgccggccg tccggatgaa       720
     atcggcgaga tggccgcagc ggttgcggtc ttcaaggcga acggcctggc catcaagcgc       780
     ctgaacgccc aggaggcggc gatgcgcgcc aagagcgacg acctgcagtc gagcatgtct       840
     gtcgtcgtgg cagcggcagc agccggcgat ttcggccacc gcatcagcaa ggattacgag       900
     gacgataacc tcaatcagtt cgccggcaac atcaacatgc tgctatcgag cgtcgatgcc       960
     ggcatcggtg agacccgccg cgtcatcgca agccttgccg aaggcgacct cacccagacg      1020
     atgagcggca acttccaggg cgccttcgcc gagctgcagc agaacgtcaa caataccttc      1080
     gttaccctgc aggcgacgat gcgcgaagtg cgcgagacga cggaggcgat gaacggcaac      1140
     accgccgagc tgcgcaatgc cagcgacgac ctgtcgaagc gcaccgagca gcaggcagcc      1200
     gccctcgaag agacctcggc ggcactcgac gagatcaccg ccgtcgtcca gaattccacc      1260
     gagcgggcgc atgaagccac catcatggta tccgaagcca aggagaatgc cggccgctcc      1320
     ggcgtcgtcg ttcgcaatgc cgtcgaggcc atgggccgga tcgagcaggc ctcgcgcgaa      1380
     atcagccaga tcatcaacgt catcgatgag atcgccttcc agaccaactt gctggcgctg      1440
     aatgccggtg tcgaggcggc acgcgccggc gatgccggaa agggttttgc ggtggtggcg      1500
     caggaagtgc gcgaactcgc ccagcgttcg gcgacggctg ccaaggacat caaggcgctg      1560
     atcaccaaat ccggcaacga ggtgcaggtc ggcgtcaagc tggtccaggc gactggcgag      1620
     gcgctggccg aaatcggcac ccgcgttatc gccatcaatg accatatcca ttcgatcgcg      1680
     acggctgcga ccgaacagtc gaccggcctc aaggaagtca ataccgccgt caaccagatg      1740
     gaccaggtga cacagcagaa cgctgcgatg gtggaagaga cctccgccgc cacgcacagg      1800
     ctttcggccg aagccggtgg cctggtgcgc ctcattgccc gcttcaaact gtcggatgat      1860
     gcgccggcac ccgcggcgct cgtccgcaac gagccgcatc ggccggtcgc ctcgcccgcc      1920
     cgccgcgcaa tcgccaaggt cgcacgcgcc ttcggcggca atgccgccgc agccgaacag      1980
     agctgggaag agttctga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page