(data stored in ACNUC7421 zone)

EMBL: CP001622.PE98

CP001622.PE98        Location/Qualifiers
FT   CDS_pept        93823..95343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0099"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: rec:RHECIAT_CH0000482
FT                   two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54410"
FT                   /db_xref="GOA:C6AZ84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ84"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54410.1"
FT                   /translation="MPIQDQGDNPSAESPAAGEAARAPCPSAGLFGGLSGKLLWLTVFF
FT                   IMLAEILIFFPSVASMRVRWLQDRLNTAAAAAIVIDGLQPVELPRALQKETLEATGTKA
FT                   IVLRKDGTSRLLATTDMPTSVDEAYDLTDVPPVTAIRDALDTLVFGGGRMIRVYGPVGD
FT                   TNTGVEVVMKDRPLRRAMFVYSRNVLLLSVLISLFTATLIFFAINRILIGPIRRLTGSM
FT                   QQFSSDPDNPAHIYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVSKINH
FT                   DMRNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESAPRRR
FT                   HIRLLELTQDVKDMLAIDPQSGIEFAEQIGAELEVDADGEQLFRVIHNLCRNALQALTS
FT                   PGEGGPGSVRRITVSAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGTGLGL
FT                   TIARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLEDYRSRAHIEK"
     atgccgattc aagatcaggg cgataatcct tcggcggaaa gcccggccgc cggcgaggct        60
     gcaagggcgc cgtgcccgtc tgccggcctg ttcggcggcc tttccggcaa gctgctctgg       120
     ctcaccgtct tcttcatcat gctcgccgaa atcctgatct tctttccctc ggtcgccagc       180
     atgcgcgtgc gctggctgca ggacaggctg aatacggccg ctgccgccgc catcgtcatc       240
     gatggcctgc agccggtcga gctgccgcgc gcgctgcaga aagagacgct ggaggcgacc       300
     ggcaccaagg cgatcgtact gcgcaaggac ggcacctcgc ggctgctggc gacgaccgat       360
     atgccgacct ccgtcgatga ggcctacgat ctgaccgacg tgccgccggt aacggcaatc       420
     cgcgatgcgc tcgacacgct ggttttcggc ggcggcagga tgatccgcgt ctatggtccc       480
     gtcggcgaca ccaataccgg cgtcgaggtg gtgatgaagg acaggccgct gcgtagggcg       540
     atgttcgtct attcccgcaa tgtcctgttg ctgtcggtgc tgatctcgtt gttcacggcg       600
     acgctgatct tctttgcgat taaccgcatc ctcatcggcc cgatccgccg gctgaccggc       660
     agcatgcagc aattctcctc cgatcccgac aacccggccc atatctatat cggcgacggc       720
     ggccgcgacg aactggcggt cgccggccgc aacctcacct cgatgcagat ggagctgcaa       780
     aagacgctga agcagcagaa gaacctggca gcgctcggcc tcgccgtttc caagatcaat       840
     cacgacatgc gcaatatcct ggcgtctgcg cagctgatgt cggaccggct ggtcgatgtc       900
     gatgacccga tggtgaaaag cttcgccccg aagctcttgc gcaccatcga ccgcgccgtc       960
     ggctacacca ccgaggtgct gtcctacggc aaggcgagcg aatccgcacc gcgccgccgc      1020
     catatccgcc tgttggaact gacccaggac gtcaaggaca tgctggcgat cgatccgcaa      1080
     agcggcatcg aattcgccga gcagatcggc gccgagcttg aggttgatgc cgatggcgaa      1140
     cagcttttcc gcgtcatcca caatctctgc cgcaacgcgc tgcaggcgct gacctcgccg      1200
     ggcgagggcg gcccgggctc cgtcaggcgc atcaccgttt ccgcccagcg tgtcggcagc      1260
     gtcgtcagca tcaccgtgga tgataccggt cccggcatgc cgctgaaggc gcgccagaac      1320
     ctctttgccg ccttccgcgg ctcggcccgc tccggcggca ccggcctcgg cctcaccatc      1380
     gcccgcgagc tggtgctcgc ccatggcggc acgatcgcgc tggtggaaaa accgacggtc      1440
     ggcacgcagt tccgcatcga gatccccgat cgcccggttt cgctggagga ttaccgcagc      1500
     cgggcgcaca ttgaaaagtg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page