(data stored in ACNUC7421 zone)

EMBL: CP001622.PE99

CP001622.PE99        Location/Qualifiers
FT   CDS_pept        96024..97955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54411"
FT                   /db_xref="GOA:C6AZ85"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ85"
FT                   /inference="similar to AA sequence:KEGG:Arad_4537"
FT                   /protein_id="ACS54411.1"
FT                   /translation="MAFVLNTFGRLQLVDGEGSLVAFPEKGLLLLVYLLTTGEGSADRT
FT                   TLARFLWGDADRDVALSTLRKLISRVKARQAELGINILSSQGNMVSLDRKSLSSDLLLS
FT                   ETDEAVASFSLLKHLVKLLNQPFLGPVHCHSREFQQWLAEREKCHIDLLANTLKTVSRR
FT                   AQSRAESELLRKAAIILFRTEPKDPDTLQLLIEIFKAEEEVESLRTYFEQRRNSISRGI
FT                   AVRGASDGADTKPVRPALVPSREKHVTAASLEPEDVSIAIPRLVLLPPRNQSIHPQAGF
FT                   LAASLVEDITIGFCAFNSLQVIAPYSAVQIGHHMETQKAFFERHHVNYILDTRISNAGD
FT                   DVTLFAQLIFFDQNQIVWAERFSLDHRDLVKDRRTVSRRIALSISSEIERHEALREDLN
FT                   PAAYHRYLVGRRHLARLTLPNLRRARKEMKAALSLSPDFAPALSSMARTYSKEWLLTAR
FT                   GDIDLLKTAEILAKQATETRPDFADGYREFGVAKLLQGAFDESAEAMEVAESLAPHYAD
FT                   VIADYADTLVHCSLPAIALRKIERAIELNPLSPDTYFWTAAGANYALGEFEASLDYIGQ
FT                   MADASLADRLAAASWAMLGHQDKARIFVRRFREVNPDFDVDKWLSAVPSKEQWHKDLYR
FT                   EGLKKAGF"
     atggcttttg ttctaaacac ctttggcagg ttgcagctcg ttgacgggga ggggagcctc        60
     gtcgcctttc ccgagaaagg tttgctgctt ctcgtctatt tgttgacgac cggtgaaggt       120
     tcggcggatc gaacgacctt ggcgcgtttt ctgtggggcg atgccgatag ggacgttgcg       180
     ctttcgacgt tgcgtaagct gatttcgaga gtgaaggccc gtcaagccga actcggaata       240
     aacattctct catcccaggg caacatggtc tctctcgacc gaaagtcctt gtcttccgac       300
     ctcctgctat ccgagaccga cgaagcggtc gcgtcgttct ctctgcttaa acatcttgtg       360
     aagctgctga accaaccctt tctggggccg gttcactgcc acagccgcga gtttcaacag       420
     tggcttgccg agcgcgaaaa atgccatatc gaccttctcg caaatacatt gaaaacggta       480
     tcgcgacgag cgcagtcgag agcggaatca gaactcctgc gaaaggccgc cattatcctg       540
     tttcggacgg aaccgaagga tccggatacg ctgcagttgc tgatagagat attcaaggcg       600
     gaggaagagg ttgaatcgct tcggacctat ttcgaacagc ggcgtaattc gatttcgcga       660
     gggatcgcgg tacgcggcgc atccgacggc gctgacacaa aacccgttcg cccggcgtta       720
     gtgccgtcaa gggaaaaaca cgtaaccgct gcttcccttg agcccgagga cgtcagcatt       780
     gcaattcctc gcctggtgct gcttccaccc agaaatcaat ccattcatcc ccaagccggt       840
     tttttagctg cgtctttggt ggaggatatc acgattggat tttgcgcctt caacagcctg       900
     caggtcatag ccccatattc ggcggtgcaa attggccacc acatggagac ccagaaggcc       960
     ttctttgaac gacatcacgt caattacatt ctcgacactc ggatcagcaa tgcgggcgat      1020
     gacgtcaccc tgttcgccca actgatcttt tttgaccaga atcaaattgt ctgggcagag      1080
     aggttcagcc ttgatcatcg ggatcttgtc aaagacagga ggactgtctc tcgacggatt      1140
     gctctttcca tatccagcga aatcgagcgc catgaggcgt tgcgcgagga tttgaacccg      1200
     gctgcctacc atcgatatct cgttggcagg cggcatctgg cgcggctgac acttccgaat      1260
     ctacggcgtg cgcgcaagga gatgaaagcc gcgctcagcc tcagccccga tttcgcaccg      1320
     gcgctgagtt caatggcgcg gacttactcc aaggaatggt tgttgaccgc gcggggtgat      1380
     atcgatctgt tgaaaacggc agagatcttg gcaaagcagg ccaccgaaac gcgtccagat      1440
     tttgccgatg gatatcgcga gttcggcgtg gcgaaattgt tgcagggtgc atttgacgaa      1500
     agcgccgagg caatggaagt ggcggagagc cttgccccgc actatgcgga tgttattgcc      1560
     gactacgccg acactttggt tcattgttcg ctccctgcca tcgccttgcg aaagatcgag      1620
     cgggcaatcg agctgaaccc gctcagcccc gacacctatt tctggaccgc tgccggcgca      1680
     aattatgccc ttggcgaatt cgaagcttcg ctggattaca ttgggcagat ggccgatgcc      1740
     agtttggccg acaggctagc ggccgcaagc tgggccatgt tgggccacca ggacaaggcg      1800
     cggatcttcg tcaggaggtt tcgcgaagtc aatccggact tcgacgtgga caaatggctg      1860
     tctgcggttc cgagtaagga gcaatggcat aaggatcttt accgagaagg cctgaagaaa      1920
     gctggatttt aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page