(data stored in ACNUC7421 zone)

EMBL: CP001630.PE1

CP001630.PE1         Location/Qualifiers
FT   CDS_pept        98..1831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bha:BH0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33975"
FT                   /db_xref="GOA:C6WCF4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU33975.1"
FT                   /translation="MSDHQADLGLVWEQVVEELANSALSSSTLSPQQRAWMRVTRPIGL
FT                   LDGTALLAAPSDFAKEAIERALREPITAALSRRLGRAVSLAVKVDSPEPPMASGPPTTP
FT                   IPVPMPPVPPSVAHGITFGQQVLGPVGPNGQTSLPIGGQADGPAGPPPPAPTGLPLEQP
FT                   ANAQAPAESPESDAEPEEGDEERETLATVNEIWPKFSRGAGGQPTPPSGTPFTRPANPA
FT                   SSQTRLNEKYNFDTFVIGASNRFAHAAAVAVAEAPARAYNPLFIWGESGLGKTHLLHAV
FT                   GHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRKVAFQRRYRDIDVLLVDDIQFLEGKE
FT                   GTQEEFFHTFNTLHNSNKQIVVSSDRPPKRLETLEDRLRTRFEWGLITDIQPPELETRI
FT                   AILRKKAAQDRLAAPAEVLEFIAARVVRNIRELEGALIRVTAFASLNRQPVDVQLAEIV
FT                   LRDLIPDSHVPEITAPTIMAVTAEFFEVTIEDLCGPGKTKVLSTARQISMYLCRELTDL
FT                   SLPKIGQTFGGRDHTTVMYADKKIRKEMAERRRIYDQVQELTSRIKQRSRYLVAPPVDP
FT                   T"
     gtgtccgacc accaggccga cttgggtctc gtgtgggagc aggtggtgga ggagctggcg        60
     aacagcgccc tctcgtccag caccttgtcc ccgcagcagc gcgcgtggat gcgggtgacc       120
     cgaccgatcg gcctgctcga cgggacggcc ctgctcgcgg cgcccagcga cttcgccaag       180
     gaggcgatcg agcgggccct gcgcgagccc atcacggccg cgctgtcccg caggctcggc       240
     cgcgcggtct cgctcgcggt gaaggtggac tcgccggagc cgccgatggc gagcggcccg       300
     ccgacgaccc cgatccccgt gcccatgccg ccggtcccgc cgagcgtcgc gcacggcatc       360
     accttcggcc agcaggtgct cggcccggtc ggcccgaacg gccagacctc gctgcccata       420
     ggcggtcagg ccgacggccc cgcaggtccg ccgcccccgg ccccgaccgg tctcccgctg       480
     gagcagcccg cgaacgcgca ggcgcccgcg gagagcccgg agtcggacgc cgagccggag       540
     gagggcgacg aggagcgcga gacgctcgcg accgtcaacg agatctggcc gaagttctcc       600
     aggggcgcgg gcggtcagcc gaccccgccg agcgggacgc cgttcacccg gcccgcgaac       660
     ccggcgtcct cgcagacccg gttgaacgag aagtacaact tcgacacctt cgtcatcggc       720
     gcctcgaacc ggttcgccca cgcggcggcg gtcgcggtgg ccgaggctcc cgccagggcg       780
     tacaacccct tgttcatctg gggcgagtcc ggtctgggga agacgcacct gctccacgcg       840
     gtcgggcact acgcgcagcg tttgttcccc gggatgcggg tccgctacgt gtcgaccgag       900
     gaattcacga acgacttcat caactcgctg cgcgacgacc ggaaggtcgc cttccagcgc       960
     cgctaccggg acatcgacgt cctcctcgtg gacgacatcc agttcctgga gggcaaggag      1020
     gggacgcagg aggagttctt ccacaccttc aacaccctcc acaactcgaa caagcagatc      1080
     gtggtgtcct cggaccggcc gccgaaacgg ctggagaccc tggaggaccg gctgcggacg      1140
     cggttcgagt ggggcctcat cacggacatc cagccgcccg agctggagac gcggatcgcg      1200
     atcctgcgga agaaggccgc gcaggaccgg ttggcggcgc ccgccgaggt gctggagttc      1260
     atcgcggcca gggtggtgcg gaacatccgc gagctggagg gcgcgctgat ccgggtcacg      1320
     gcgttcgcgt cgctgaaccg gcagccggtc gacgtccagc tcgccgagat agtgctgcgc      1380
     gacctgatcc cggactcgca cgtcccggag atcaccgcgc ccaccatcat ggcggtgacc      1440
     gccgagttct tcgaggtcac catcgaggac ctgtgcggcc ctggcaagac caaggtgctg      1500
     tccacggcca ggcagatctc catgtacctg tgccgcgagc tgacggacct gtcgctgccg      1560
     aagatcgggc agacgttcgg cggccgggac cacaccacgg tcatgtacgc ggacaagaag      1620
     atccgcaagg agatggccga gcgcaggcgc atctacgacc aggtccagga gctcacctcg      1680
     cgcatcaagc agcgctcgcg ctacctggtg gcccccccgg tcgatccgac ctga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page