(data stored in ACNUC7421 zone)

EMBL: CP001630.PE10

CP001630.PE10        Location/Qualifiers
FT   CDS_pept        complement(12873..13304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0010"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gur:Gura_3338 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33984"
FT                   /db_xref="GOA:C6WCG3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG3"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACU33984.1"
FT                   /translation="MSLLDRGREQILSIFRIVIAFFMICHGAQKVFGVLGGKGGFSPLN
FT                   WPSGPAGLIEVVGGALVLIGLWTRVASIIVSGAMAYAYFVVHQPMGLLPIENKGELAAV
FT                   YSWAFLLLAFTGPGVWAVDTILASRKKNAENRELANAAA"
     atgagcttgt tggaccgtgg tcgggagcag atcctctcga tcttccggat cgtgatcgcc        60
     ttcttcatga tctgccacgg agcccagaag gtcttcggcg tgctgggcgg caagggcggc       120
     ttctcgcccc tgaactggcc ctcgggcccc gcgggcctca tcgaggtcgt cggcggtgcg       180
     ctcgtcctga tcggtctctg gacccgcgtg gcgtcgatca tcgtctccgg cgccatggcc       240
     tacgcctact tcgtcgtcca ccagccgatg ggcctgctcc ccatcgagaa caagggcgaa       300
     ctggcggcgg tctactcgtg ggccttcctg ctcctggcct tcacgggtcc gggcgtctgg       360
     gcggtcgaca ccatcctggc ctccaggaag aagaacgcgg agaaccggga gctggcgaac       420
     gcggcagcct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page