(data stored in ACNUC7421 zone)

EMBL: CP001630.PE100

CP001630.PE100       Location/Qualifiers
FT   CDS_pept        109492..110394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0100"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34074"
FT                   /db_xref="GOA:C6WDS9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS9"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU34074.1"
FT                   /translation="MVAPVPRIAYFGPRGTFTEQAARGFGSDLEPRETIPAALEAARTG
FT                   EAELACVPVENSVEGAVPATMDALAEGAPLIAVAETVLAVRFSLLVRPGGGPVRTVASH
FT                   PHALAQVRHWLAANLPDAVAVAATSTAAAAVAVQRGEHDAAVTAPVAAEHYPLEVAATD
FT                   LADVRDAKTRFLLLRGPGALPEPTGSDRTSVVVTAPDRVGVLSDVLVEFALRGVNLTRI
FT                   ESRPTKGPLGEYRFYIDFDGHVAEPRVGDALAALRRHCPDTRFLGSYPKAVREDVVAEN
FT                   ADFVAAAEWVVAIREGRGA"
     atggttgcgc ccgtgccacg catcgcctac ttcggcccca ggggaacctt caccgagcag        60
     gccgcgcgcg gcttcggctc ggacctggaa ccccgcgaga ccattccagc agccctggaa       120
     gccgcccgca cgggtgaggc cgaactcgcc tgcgtgccgg tggagaactc cgtcgagggc       180
     gccgtccccg cgaccatgga cgcgctcgcc gagggcgccc ccctgatcgc cgtcgccgag       240
     accgtcctcg cggtcaggtt cagcctgctg gtccgtccgg gtggtggacc ggtccgcacc       300
     gtcgccagcc acccgcacgc gctcgcccag gtgcggcact ggctcgccgc gaacctgccc       360
     gacgccgtcg cggtggccgc gacctccacg gcggcggcgg ccgtcgcggt gcagcgcggc       420
     gagcacgacg cggcggtgac cgcgcccgtg gcggccgagc actacccgct ggaggtcgcg       480
     gcgaccgacc tcgcggacgt gcgcgacgcc aagaccaggt tcctgctgct gcgcgggccc       540
     ggagccctgc ccgagcccac cggctccgac cgcacctcgg tcgtggtgac cgcgccggac       600
     cgggtgggcg tgctgtcgga cgtgctggtc gagttcgcgc tgcgcggcgt caacctgacc       660
     aggatcgagt cccggcccac caagggcccg ctcggggagt accggttcta catcgacttc       720
     gacggccacg tcgccgagcc gagggtgggg gacgcgctgg ccgcgctgcg caggcactgc       780
     ccggacaccc ggttcctcgg ctcctacccg aaggccgtgc gcgaggacgt ggtggcggag       840
     aacgcggatt tcgtggctgc ggccgagtgg gtcgtggcga tcagggaggg caggggcgcg       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page