(data stored in ACNUC7421 zone)

EMBL: CP001630.PE101

CP001630.PE101       Location/Qualifiers
FT   CDS_pept        110391..111002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0101"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: lch:Lcho_3955
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34075"
FT                   /db_xref="GOA:C6WDT0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACU34075.1"
FT                   /translation="MRLLLVRHGETASNVAMALDSLPPGPPLTEAGRAQAEALARDLAD
FT                   VPVTAVHASVAVRAQQTAAPVAAAHGLEVRVVDGVQEIFCGELEGRSDREAYGTFMRTV
FT                   RSWAEGDLDVPLPGGESGRQVLDRYLAAVEEVTAGRAEDDVVVLVSHGASLRMAALALA
FT                   TNVTPALMAAGLLPNTGRVELERVGDGWVCTSWTGVDVAG"
     gtgaggttgt tgctggtcag gcacggcgag acggcgtcga acgtggcgat ggcgctggac        60
     agcctgccgc cgggcccgcc gctcaccgag gccggtcggg cccaggcgga ggcgctggcg       120
     cgggacctgg cggacgtgcc ggtcaccgcc gtgcacgcga gcgtcgcggt gcgggcccag       180
     cagaccgctg cgcccgtcgc ggcggcgcac ggcctggagg tccgggtcgt ggacggcgtg       240
     caggagatct tctgcggcga gctggagggc cgcagcgacc gcgaggcgta cgggaccttc       300
     atgcggaccg tgcgctcgtg ggccgagggc gacctggacg tgccgctgcc cggcggcgag       360
     tccggcaggc aggtcctgga ccggtacctg gcggccgtgg aggaggtcac cgccgggcgc       420
     gcggaggacg acgtggtggt gctggtcagc cacggcgcct cgctgcgcat ggcggcgctg       480
     gccctggcga ccaacgtgac cccggccctg atggccgccg ggctgctgcc caacaccggg       540
     cgggtggagc tggagcgggt cggcgacggc tgggtctgca cctcgtggac cggcgtggac       600
     gtggcgggct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page