(data stored in ACNUC7421 zone)

EMBL: CP001630.PE102

CP001630.PE102       Location/Qualifiers
FT   CDS_pept        complement(111845..112261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34076"
FT                   /db_xref="InterPro:IPR025680"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34076.1"
FT                   /translation="MVTRLRISHQRGKPILAASVAELDAAIDLISGDSARQECPSMVEI
FT                   TIEEDPYGHAYIDAGIGVEQGFVHLNGPDTYRTTVGDPNAAGTVLYDCCGNGEDVPARE
FT                   EVPLATVHAVLAAFLAHDGLIPDDHPDLHLSPTG"
     gtggtgacga ggttgcggat cagccaccag cgcggcaagc cgatcctcgc ggccagcgtg        60
     gccgagctgg acgcggccat cgacctgatc agcggcgact cggcccggca ggagtgcccg       120
     tcgatggtgg agatcaccat cgaggaggac ccctacgggc acgcctacat cgacgcgggc       180
     atcggcgtcg aacaggggtt cgtccacctc aacggccccg acacctaccg gaccacggtc       240
     ggcgacccga acgccgccgg cacggtgctg tacgactgct gcggcaacgg cgaggacgtc       300
     cccgcccgcg aggaggtccc cctcgcgacc gtccacgccg tcctggccgc cttcctcgcc       360
     cacgacggcc tgatccccga cgaccacccc gacctgcacc tctcccccac cggctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page